Length: 119 amino acids
Molecular Weight: Calculated as 13.1 kDa (theoretical)
Amino Acid Sequence:
MPHFKRAAVYEEQKRTGKWGQLVEETKDRIPEYSNKTIAKISHLDNGCLWPEIKVSFSHHLSILQSMCLHFIISILFSKYIFVFLFAFLLPSAFPLFILHSTLFRKPCLSIIGFLKTKV
Structural similarity to Pmp3p suggests potential involvement in cation transport .
Localizes to cytoplasmic punctate structures, indicating possible vesicular or organelle-associated activity .
Genetic Interactions
YOR015W exhibits functional associations with proteins involved in diverse cellular processes:
YOR015W was identified in a plasmid region containing RTS1, ERP4, and PET127 during investigations into mitochondrial DNA inheritance bias. While PET127 overexpression suppressed mitochondrial genome instability, YOR015W was ruled out as the causative gene due to its lack of functional promoters and distance from RTS1 .
High-copy plasmids containing YOR015W did not restore wild-type mtDNA inheritance in HS ORI5-1 mutants, unlike PET127 .
No essential role in viability: YOR015W deletion does not affect yeast survival under standard conditions .
Research Use: Recombinant YOR015W serves as a tool for antibody production ([MyBioSource, MBS7190451] ) and interaction studies .
Commercial Availability:
Protein localization provides crucial clues to function. For YOR015W, consider these methodological approaches:
Fluorescent Protein Tagging Method:
Create a GFP-fusion construct by integrating GFP at either the N- or C-terminus of YOR015W
For cytoplasmic degradation protection, consider using a GFPdeg variant that is rapidly degraded in the cytoplasm but protected in organelles (as used in mitochondrial localization studies)
Express the fusion protein under control of a native or inducible promoter
Visualize using fluorescence microscopy with appropriate organelle markers
Immunolocalization Method:
Generate an HA-tagged YOR015W construct using commercially available yeast HA Tag Collections
Perform immunofluorescence using anti-HA antibodies
Co-stain with organelle-specific markers
Analyze using confocal microscopy
Each method has advantages and limitations. GFP tagging allows observation in living cells but may affect protein folding. Immunolocalization provides higher specificity but requires cell fixation. Consider validating results with complementary approaches.
A systematic approach combining multiple experimental designs will yield the most comprehensive results:
Experimental Design Strategy:
| Approach | Design Type | Description | Advantages |
|---|---|---|---|
| Gene deletion | Between-subjects | Compare wild-type with ΔYOR015W strain across conditions | Reveals phenotypic consequences |
| Overexpression | Between-subjects | Compare strains with/without YOR015W overexpression | Identifies gain-of-function effects |
| Growth conditions | Full factorial | Test multiple factors (temperature, carbon source, stress) | Reveals condition-specific functions |
| Time-course analysis | Repeated-measures | Sample at multiple timepoints | Captures dynamic responses |
For statistical robustness, employ a full factorial design testing multiple variables simultaneously. For example, a 3×2 design might include:
Factor 1: Growth medium (minimal, rich, stress-inducing)
Factor 2: Temperature (30°C, 37°C)
This design allows analysis of both main effects and interactions, providing more comprehensive insights than testing single variables . For time-course experiments, a repeated-measures design reduces variability by using the same cultures across timepoints.
Multiple resources exist to facilitate research on uncharacterized yeast proteins:
Genetic Resources:
Yeast Knockout Collections: Contain ΔYOR015W deletion strains
Tagged ORF Collections: Include YOR015W with various tags (HA, TAP, GST, YFP)
Molecular Barcoded Yeast (MoBY) ORF Collection: Useful for identifying drug resistance mutations
Computational Resources:
Saccharomyces Genome Database (SGD): Comprehensive database of yeast genes
YEASTRACT database: Provides information on transcriptional regulators
Research Networks:
The Yeast ORFan Gene Project: Consortium focusing specifically on uncharacterized yeast genes
"Adopt-a-protogene" project: Offers resources and workshops for studying uncharacterized genes
For effective research, consider combining multiple resources to develop a comprehensive characterization strategy.
Transcriptional regulation is a critical aspect of protein function studies. For YOR015W, consider these methodological approaches:
Promoter Engineering Strategy:
Replace the native YOR015W promoter with tunable promoters of varying strengths
Options include constitutive promoters (TEF1, GPD) and inducible systems (GAL1, CUP1)
Use quantitative RT-PCR to confirm expression levels under different conditions
Correlate expression levels with phenotypic outcomes
Codon Optimization Considerations:
When expressing recombinant YOR015W, conventional codon optimization may be insufficient. Recent research shows that:
Simple replacement with high-frequency codons doesn't always increase expression
Consider the kinetic effects of protein translation, not just tRNA abundance
Specific codon combinations affect ribosomal transcription speed and proper protein folding
Design optimization strategies that account for translation rate rather than codon frequency alone
Expression System Selection:
These approaches should be customized based on your specific research questions about YOR015W.
Descriptive Statistical Methods:
Central tendency measures (mean, median, mode) to summarize data
Variability measures (standard deviation, range) to assess data spread
For growth experiments, calculate maximum growth rates during exponential phase
Inferential Statistical Approaches:
For comparing strains (e.g., wild-type vs. ΔYOR015W):
t-tests for simple comparisons between two conditions
ANOVA for multi-factor experiments
Post-hoc tests (Tukey's HSD) for multiple comparisons
For analyzing experimental variability:
Statistical Considerations for High-Throughput Data:
When analyzing genomic data collections (e.g., RNA-seq comparing wild-type and ΔYOR015W):
Remember that statistical significance should be coupled with biological relevance when interpreting results.
For structural studies of YOR015W, optimizing protein production is essential:
Signal Peptide Optimization:
Test multiple signal peptides to identify optimal secretion efficiency
Consider native S. cerevisiae signals (Aga2p, Crh1p, Plb1p, MFα1p)
Alternatively, test heterologous signal peptides from Kluyveromyces
Quantify secretion efficiency for each signal peptide variant
Protein Translocation Enhancement:
Optimize both co-translational and post-translational translocation pathways:
Regulate Sec61p expression (for post-translational translocation)
Consider overexpression of Ssa1p (70 kDa heat shock protein)
Engineer the signal recognition particle (SRP) for co-translational pathways
Protein Folding Optimization:
Co-express chaperones like BiP and Pdi1p to assist proper folding
Note that co-overexpression effects vary between proteins - what works for one protein may not work for YOR015W
Design experimental comparisons to identify optimal chaperone combinations
Glycosylation Engineering:
If YOR015W undergoes glycosylation:
Address potential hypermannose glycan structures that can reduce activity
Engineer glycosylation processes to enhance production and bioactivity
Consider glycosylation site mutations if they interfere with structural studies
These approaches should be systematically tested and optimized for YOR015W-specific requirements.
Computational predictions can guide experimental investigations of YOR015W:
Integrated Data Analysis Approach:
Combine heterogeneous genomic data sources
Analyze protein-protein interactions, gene expression correlations, and evolutionary conservation
Apply machine learning to discover meaningful signals in experimental data
Use these predictions to inform targeted laboratory experiments
Functional Structure Assessment:
Analyze the organization of genomic data related to YOR015W
Identify potential functional modules or pathways
Focus experimental validation on the most probable functions
Evolutionary Analysis:
Compare YOR015W sequence across related yeast species
Identify conserved domains that suggest functional importance
Determine if YOR015W is an "emerging gene" present only in S. cerevisiae
Use conservation patterns to prioritize functional hypotheses
The computational predictions should guide experimental design rather than replace experimental validation.
When facing contradictory results about YOR015W function:
Systematic Reconciliation Strategy:
Catalog all experimental conditions and methodologies that produced contradictory results
Identify key variables that differ between experiments (strains, media, temperature, etc.)
Design factorial experiments that systematically vary these conditions
Test for interaction effects that might explain contradictions
Statistical Reconciliation:
Apply meta-analysis techniques to integrate contradictory findings
Weight results based on sample size, methodology rigor, and replication
Consider Bayesian approaches to update confidence in various hypotheses as new data emerges
Functional Testing Under Diverse Conditions:
For example, if YOR015W deletion shows no phenotype in standard conditions but significant effects in other studies:
Test the deletion strain under diverse stress conditions (oxidative, osmotic, temperature)
Examine growth at different phases (log, post-diauxic shift)
Some uncharacterized mitochondrial proteins are upregulated during post-diauxic shift
Systematically vary media composition, particularly carbon sources
Multi-Method Validation:
Combine complementary approaches:
Genetic (deletion, overexpression)
Biochemical (protein interactions, enzymatic assays)
Cellular (localization, stress responses)
Computational (predictions, data integration)
This systematic approach can resolve apparent contradictions and build a coherent model of YOR015W function.