Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR015W (YOR015W)

Shipped with Ice Packs
In Stock

Description

Protein Characterization

Sequence Details

  • Length: 119 amino acids

  • Molecular Weight: Calculated as 13.1 kDa (theoretical)

  • Isoelectric Point: Predicted pI of 9.3

  • Amino Acid Sequence:
    MPHFKRAAVYEEQKRTGKWGQLVEETKDRIPEYSNKTIAKISHLDNGCLWPEIKVSFSHHLSILQSMCLHFIISILFSKYIFVFLFAFLLPSAFPLFILHSTLFRKPCLSIIGFLKTKV

Recombinant Production

ParameterDetails
HostEscherichia coli (E. coli)
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in sterile water with 5–50% glycerol for stability

Functional Insights

Putative Roles

  • Structural similarity to Pmp3p suggests potential involvement in cation transport .

  • Localizes to cytoplasmic punctate structures, indicating possible vesicular or organelle-associated activity .

Genetic Interactions
YOR015W exhibits functional associations with proteins involved in diverse cellular processes:

Interacting ProteinFunctionAssociation Score (STRING)
ERP4ER-Golgi transport0.791
PET127Mitochondrial RNA processing0.702
RTS1Protein phosphatase 2A regulation0.601
SRC1Nuclear membrane organization, telomere roles0.467
Data derived from STRING database analysis .

Research Findings

Mitochondrial Genome Stability Study

  • YOR015W was identified in a plasmid region containing RTS1, ERP4, and PET127 during investigations into mitochondrial DNA inheritance bias. While PET127 overexpression suppressed mitochondrial genome instability, YOR015W was ruled out as the causative gene due to its lack of functional promoters and distance from RTS1 .

Key Observations

  • High-copy plasmids containing YOR015W did not restore wild-type mtDNA inheritance in HS ORI5-1 mutants, unlike PET127 .

  • No essential role in viability: YOR015W deletion does not affect yeast survival under standard conditions .

Applications and Availability

  • Research Use: Recombinant YOR015W serves as a tool for antibody production ([MyBioSource, MBS7190451] ) and interaction studies .

  • Commercial Availability:

    • Catalog No.: RFL8500SF (Creative BioMart)

    • Species: S. cerevisiae strain S288C

Limitations and Future Directions

  • Uncharacterized Pathways: No experimentally validated pathways currently link YOR015W .

  • Functional Studies Needed: Targeted mutagenesis or overexpression experiments could clarify its role in cation transport or organelle dynamics.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
YOR015W; O2618; OR26.05; YOL303.5; Uncharacterized protein YOR015W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YOR015W
Target Protein Sequence
MPHFKRAAVYEEQKRTGKWGQLVEETKDRIPEYSNKTIAKISHLDNGCLWPEIKVSFSHH LSILQSMCLHFIISILFSKYIFVFLFAFLLPSAFPLFILHSTLFRKPCLSIIGFLKTKV
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What approaches can be used to determine the cellular localization of YOR015W?

Protein localization provides crucial clues to function. For YOR015W, consider these methodological approaches:

Fluorescent Protein Tagging Method:

  • Create a GFP-fusion construct by integrating GFP at either the N- or C-terminus of YOR015W

  • For cytoplasmic degradation protection, consider using a GFPdeg variant that is rapidly degraded in the cytoplasm but protected in organelles (as used in mitochondrial localization studies)

  • Express the fusion protein under control of a native or inducible promoter

  • Visualize using fluorescence microscopy with appropriate organelle markers

Immunolocalization Method:

  • Generate an HA-tagged YOR015W construct using commercially available yeast HA Tag Collections

  • Perform immunofluorescence using anti-HA antibodies

  • Co-stain with organelle-specific markers

  • Analyze using confocal microscopy

Each method has advantages and limitations. GFP tagging allows observation in living cells but may affect protein folding. Immunolocalization provides higher specificity but requires cell fixation. Consider validating results with complementary approaches.

What experimental design is most appropriate for initial functional characterization of YOR015W?

A systematic approach combining multiple experimental designs will yield the most comprehensive results:

Experimental Design Strategy:

ApproachDesign TypeDescriptionAdvantages
Gene deletionBetween-subjectsCompare wild-type with ΔYOR015W strain across conditionsReveals phenotypic consequences
OverexpressionBetween-subjectsCompare strains with/without YOR015W overexpressionIdentifies gain-of-function effects
Growth conditionsFull factorialTest multiple factors (temperature, carbon source, stress)Reveals condition-specific functions
Time-course analysisRepeated-measuresSample at multiple timepointsCaptures dynamic responses

For statistical robustness, employ a full factorial design testing multiple variables simultaneously. For example, a 3×2 design might include:

  • Factor 1: Growth medium (minimal, rich, stress-inducing)

  • Factor 2: Temperature (30°C, 37°C)

This design allows analysis of both main effects and interactions, providing more comprehensive insights than testing single variables . For time-course experiments, a repeated-measures design reduces variability by using the same cultures across timepoints.

What tools and resources are available for studying uncharacterized yeast proteins like YOR015W?

Multiple resources exist to facilitate research on uncharacterized yeast proteins:

Genetic Resources:

  • Yeast Knockout Collections: Contain ΔYOR015W deletion strains

  • Tagged ORF Collections: Include YOR015W with various tags (HA, TAP, GST, YFP)

  • Molecular Barcoded Yeast (MoBY) ORF Collection: Useful for identifying drug resistance mutations

Computational Resources:

  • Saccharomyces Genome Database (SGD): Comprehensive database of yeast genes

  • YEASTRACT database: Provides information on transcriptional regulators

  • DeepLoc-1.0: Prediction tool for protein localization

Research Networks:

  • The Yeast ORFan Gene Project: Consortium focusing specifically on uncharacterized yeast genes

  • "Adopt-a-protogene" project: Offers resources and workshops for studying uncharacterized genes

For effective research, consider combining multiple resources to develop a comprehensive characterization strategy.

How can transcriptional regulation approaches be optimized for studying YOR015W function?

Transcriptional regulation is a critical aspect of protein function studies. For YOR015W, consider these methodological approaches:

Promoter Engineering Strategy:

  • Replace the native YOR015W promoter with tunable promoters of varying strengths

  • Options include constitutive promoters (TEF1, GPD) and inducible systems (GAL1, CUP1)

  • Use quantitative RT-PCR to confirm expression levels under different conditions

  • Correlate expression levels with phenotypic outcomes

Codon Optimization Considerations:
When expressing recombinant YOR015W, conventional codon optimization may be insufficient. Recent research shows that:

  • Simple replacement with high-frequency codons doesn't always increase expression

  • Consider the kinetic effects of protein translation, not just tRNA abundance

  • Specific codon combinations affect ribosomal transcription speed and proper protein folding

  • Design optimization strategies that account for translation rate rather than codon frequency alone

Expression System Selection:

These approaches should be customized based on your specific research questions about YOR015W.

What statistical approaches are most appropriate for analyzing YOR015W characterization data?

Descriptive Statistical Methods:

  • Central tendency measures (mean, median, mode) to summarize data

  • Variability measures (standard deviation, range) to assess data spread

  • For growth experiments, calculate maximum growth rates during exponential phase

Inferential Statistical Approaches:

  • For comparing strains (e.g., wild-type vs. ΔYOR015W):

    • t-tests for simple comparisons between two conditions

    • ANOVA for multi-factor experiments

    • Post-hoc tests (Tukey's HSD) for multiple comparisons

  • For analyzing experimental variability:

    • Control variability to increase statistical power

    • Standardize experimental procedures

    • Provide uniform instructions

    • Control for extraneous variables

Statistical Considerations for High-Throughput Data:

  • When analyzing genomic data collections (e.g., RNA-seq comparing wild-type and ΔYOR015W):

    • Address multiple testing correction

    • Consider meta-analysis approaches

    • Evaluate effect size, not just statistical significance

    • For contradictory results, meta-analysis can integrate different experimental outcomes

Remember that statistical significance should be coupled with biological relevance when interpreting results.

How can secretory pathway engineering improve recombinant YOR015W production for structural studies?

For structural studies of YOR015W, optimizing protein production is essential:

Signal Peptide Optimization:

  • Test multiple signal peptides to identify optimal secretion efficiency

  • Consider native S. cerevisiae signals (Aga2p, Crh1p, Plb1p, MFα1p)

  • Alternatively, test heterologous signal peptides from Kluyveromyces

  • Quantify secretion efficiency for each signal peptide variant

Protein Translocation Enhancement:
Optimize both co-translational and post-translational translocation pathways:

  • Regulate Sec61p expression (for post-translational translocation)

  • Consider overexpression of Ssa1p (70 kDa heat shock protein)

  • Engineer the signal recognition particle (SRP) for co-translational pathways

Protein Folding Optimization:

  • Co-express chaperones like BiP and Pdi1p to assist proper folding

  • Note that co-overexpression effects vary between proteins - what works for one protein may not work for YOR015W

  • Design experimental comparisons to identify optimal chaperone combinations

Glycosylation Engineering:
If YOR015W undergoes glycosylation:

  • Address potential hypermannose glycan structures that can reduce activity

  • Engineer glycosylation processes to enhance production and bioactivity

  • Consider glycosylation site mutations if they interfere with structural studies

These approaches should be systematically tested and optimized for YOR015W-specific requirements.

How can computational approaches help predict the function of YOR015W?

Computational predictions can guide experimental investigations of YOR015W:

Integrated Data Analysis Approach:

  • Combine heterogeneous genomic data sources

  • Analyze protein-protein interactions, gene expression correlations, and evolutionary conservation

  • Apply machine learning to discover meaningful signals in experimental data

  • Use these predictions to inform targeted laboratory experiments

Functional Structure Assessment:

  • Analyze the organization of genomic data related to YOR015W

  • Identify potential functional modules or pathways

  • Construct a map of biological regulation and interactions

  • Focus experimental validation on the most probable functions

Evolutionary Analysis:

  • Compare YOR015W sequence across related yeast species

  • Identify conserved domains that suggest functional importance

  • Determine if YOR015W is an "emerging gene" present only in S. cerevisiae

  • Use conservation patterns to prioritize functional hypotheses

The computational predictions should guide experimental design rather than replace experimental validation.

What approaches can resolve contradictory data about YOR015W function?

When facing contradictory results about YOR015W function:

Systematic Reconciliation Strategy:

  • Catalog all experimental conditions and methodologies that produced contradictory results

  • Identify key variables that differ between experiments (strains, media, temperature, etc.)

  • Design factorial experiments that systematically vary these conditions

  • Test for interaction effects that might explain contradictions

Statistical Reconciliation:

  • Apply meta-analysis techniques to integrate contradictory findings

  • Weight results based on sample size, methodology rigor, and replication

  • Consider Bayesian approaches to update confidence in various hypotheses as new data emerges

Functional Testing Under Diverse Conditions:
For example, if YOR015W deletion shows no phenotype in standard conditions but significant effects in other studies:

  • Test the deletion strain under diverse stress conditions (oxidative, osmotic, temperature)

  • Examine growth at different phases (log, post-diauxic shift)

  • Some uncharacterized mitochondrial proteins are upregulated during post-diauxic shift

  • Systematically vary media composition, particularly carbon sources

Multi-Method Validation:
Combine complementary approaches:

  • Genetic (deletion, overexpression)

  • Biochemical (protein interactions, enzymatic assays)

  • Cellular (localization, stress responses)

  • Computational (predictions, data integration)

This systematic approach can resolve apparent contradictions and build a coherent model of YOR015W function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.