Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR225W (YOR225W)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Saccharomyces cerevisiae putative uncharacterized protein YOR225W (YOR225W) is a genetically engineered protein derived from the YOR225W gene locus in S. cerevisiae. While its precise biological function remains uncharacterized, research has elucidated structural, genetic, and expression-related insights. This article synthesizes data from genomic databases, recombinant production protocols, and functional studies to provide a comprehensive overview of this protein.

Functional Insights and Expression Patterns

3.1. Gene Expression and Regulation

  • Filamentous Growth: Overexpressed in S. cerevisiae strains exhibiting filamentous morphology, suggesting a potential role in morphogenesis .

  • Stress Responses: No direct evidence linking YOR225W to stress pathways, unlike other S. cerevisiae proteins (e.g., aldehyde reductase ari1) .

3.2. Putative Biological Roles

  • Hypothetical Functions: Based on homology or co-expression with characterized genes, YOR225W may participate in:

    • Cell Morphology: Overexpression correlates with invasive/filamentous growth .

    • Unresolved Pathways: Limited data preclude definitive functional assignments .

3.3. Genetic Mutations and Phenotypes

  • Mutant Alleles: Curated alleles in the Saccharomyces Genome Database (SGD) remain uncharacterized .

  • Synergistic Effects: No documented interactions with other S. cerevisiae genes (e.g., RAD52, PHD1) .

Research Applications and Challenges

4.1. Experimental Tools

ApplicationDetail
Protein StudiesUsed in structural or functional assays (e.g., ELISA, Western blot)
Yeast MorphogenesisModel system to study filamentous growth regulation
Strain EngineeringPotential target for CRISPR-based functional analysis

4.2. Challenges and Gaps

  • Functional Elucidation: No high-throughput screens or knockout studies reported .

  • Evolutionary Context: Unresolved orthologs in non-Saccharomyces species .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
YOR225W; O5015; O5073; YOR50-15; Putative uncharacterized protein YOR225W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YOR225W
Target Protein Sequence
MKIRPGENLSRLTNMKKLSQNLIHNVTSIMTVSDINYLLLYLIILLTLSIKQPEKKNRKE RTSCILSYYRIASLSMQNGGVPLCFVVLDCRLDSVFCKHGTMQFYWRKT
Uniprot No.

Target Background

Database Links

STRING: 4932.YOR225W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the basic characteristics of YOR225W?

YOR225W is classified as a putative uncharacterized protein in the yeast Saccharomyces cerevisiae. Current genomic data suggests it may be involved in cellular processes related to stress response, similar to other proteins identified in transcriptomic studies of yeast under various environmental conditions. While definitive function has not been established, preliminary analyses suggest it may contribute to metabolic adaptation, particularly when cells transition between fermentative and respiratory metabolism.

To characterize this protein, researchers typically begin with sequence analysis tools to identify conserved domains, motifs, and potential structural features. This can be complemented with expression studies across different growth conditions, particularly comparing glucose versus non-fermentable carbon sources like xylose, as S. cerevisiae exhibits distinct metabolic patterns between these conditions .

How is YOR225W gene expression regulated under different growth conditions?

YOR225W expression patterns appear to follow similar regulatory mechanisms observed in other yeast genes that respond to carbon source availability. Based on studies of S. cerevisiae transcriptional responses, genes can be significantly upregulated or downregulated when cells transition from glucose to alternative carbon sources.

To study YOR225W regulation:

  • Perform RT-PCR or RNA-seq analysis comparing transcript levels across different growth conditions

  • Use GeneChip studies to compare expression with other genes in related pathways

  • Analyze promoter regions for regulatory elements such as CCAAT boxes that bind transcriptional regulators like the Hap2/3/4/5 complex

  • Monitor expression changes in response to oxygen limitation, as many genes show differential expression between aerobic and oxygen-limited conditions

Researchers should note that transcript levels may change more than two-fold depending on carbon source and aeration conditions, as seen with other yeast genes involved in metabolism .

Where is YOR225W protein localized in the cell?

Determining the subcellular localization of YOR225W is crucial for understanding its potential function. While specific localization data for YOR225W is limited, methodological approaches include:

  • Fluorescent protein tagging using GFP fusion constructs

  • Immunofluorescence microscopy with antibodies against epitope-tagged versions of the protein

  • Subcellular fractionation followed by Western blot analysis

  • Comparison with localization patterns of proteins involved in similar cellular processes

If YOR225W is involved in respiratory functions as suggested by its expression patterns, it might localize to mitochondria or associate with mitochondrial membranes. For comparative analysis, researchers can reference localization patterns of other proteins that show similar expression changes between fermentative and respiratory growth conditions .

What are the most effective methods to express and purify recombinant YOR225W protein?

For successful expression and purification of recombinant YOR225W:

  • Expression system selection:

    • Homologous expression in S. cerevisiae offers proper folding and post-translational modifications

    • E. coli systems provide high yields but may lack proper modifications

    • Pichia pastoris can be used for higher eukaryotic protein processing capabilities

  • Expression optimization:

    • Use strong inducible promoters (GAL1 for yeast, T7 for E. coli)

    • Optimize codon usage for the expression host

    • Add purification tags (His6, GST, MBP) to facilitate purification

  • Purification strategy:

    • Initial capture by affinity chromatography using the fusion tag

    • Secondary purification by ion exchange or size exclusion chromatography

    • Verify purity by SDS-PAGE and Western blotting

  • Functional validation:

    • Ensure the recombinant protein maintains its native structure

    • Perform activity assays based on predicted function

This methodological approach is similar to techniques used for other yeast proteins with initially unknown functions .

How can researchers create and validate YOR225W knockout strains?

Creating and validating YOR225W knockout strains requires systematic approaches:

  • Knockout construction methods:

    • PCR-based gene deletion using selectable markers (KanMX, HIS3, URA3)

    • CRISPR-Cas9 genome editing for precise modifications

    • Conditional knockouts using regulated promoters for essential genes

  • Verification strategies:

    • PCR confirmation of correct integration

    • Southern blot analysis for single integration events

    • RT-PCR or Northern blot to confirm absence of transcript

    • Western blot to verify protein absence

  • Phenotypic characterization:

    • Growth rates in different media compositions

    • Stress tolerance assays (temperature, oxidative stress, osmotic stress)

    • Metabolic profiling comparing glucose and alternative carbon source utilization

    • Respiratory capacity assessment using oxygen consumption measurements

  • Complementation tests:

    • Reintroduction of functional YOR225W to confirm phenotype reversion

    • Expression of homologs from related species to assess functional conservation

These approaches are consistent with methodologies used in functional genomics studies of other uncharacterized yeast proteins .

What high-throughput techniques can identify potential interaction partners of YOR225W?

Identifying protein interaction partners provides crucial insights into function. Recommended high-throughput approaches include:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express epitope-tagged YOR225W (FLAG, HA, TAP tag)

    • Perform pull-down experiments under different growth conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate key interactions by co-immunoprecipitation

  • Yeast two-hybrid (Y2H) screening:

    • Use YOR225W as bait against a yeast genomic library

    • Screen for positive interactions using reporter gene activation

    • Validate interactions with targeted Y2H assays

    • Map interaction domains through truncation analysis

  • Proximity-based labeling methods:

    • BioID or TurboID fusion to YOR225W

    • In vivo biotinylation of proximal proteins

    • Streptavidin purification and mass spectrometry identification

  • Genetic interaction screening:

    • Synthetic genetic array (SGA) analysis with YOR225W deletion

    • Identification of synthetic lethal or synthetic sick interactions

    • Construction of genetic interaction networks

These complementary approaches provide a comprehensive view of protein interaction networks, similar to methods used to characterize other yeast proteins involved in metabolic pathways .

How does YOR225W potentially contribute to xylose metabolism in engineered S. cerevisiae?

S. cerevisiae engineered for xylose metabolism shows specific transcriptional responses that might involve YOR225W. To investigate its potential role:

  • Comparative transcriptomics:

    • Analyze transcript levels of YOR225W in wild-type vs. xylose-metabolizing strains

    • Monitor expression changes when shifting between glucose and xylose media

    • Compare expression patterns with known xylose metabolism genes (XYL1, XYL2, XYL3)

  • Metabolic flux analysis:

    • Perform 13C-metabolic flux analysis in YOR225W knockout vs. wild-type strains

    • Measure key metabolite concentrations during xylose fermentation

    • Identify bottlenecks or alterations in carbon flow

  • Respiratory capacity assessment:

    • Measure oxygen consumption rates in YOR225W mutants

    • Analyze TCA cycle activity and respiratory gene expression

    • Determine if YOR225W influences the respiratory response to xylose

  • Integration with regulatory networks:

    • Investigate interactions with transcriptional activators like the Hap2/3/4/5 complex

    • Analyze promoter binding by key regulators using ChIP-seq

    • Determine if YOR225W expression correlates with HAP4 transcript levels

This approach leverages findings that S. cerevisiae does not recognize xylose as a fermentable carbon source and induces respiratory proteins in response to cytosolic redox imbalance during xylose metabolism .

What role might YOR225W play in respiratory vs. fermentative metabolism?

Investigating YOR225W's role in respiratory versus fermentative metabolism requires examining its expression and function under different metabolic states:

  • Expression profiling:

    • Compare YOR225W transcript levels under glucose (fermentative) vs. non-fermentable carbon sources

    • Analyze expression changes under aerobic vs. oxygen-limited conditions

    • Determine if YOR225W follows patterns similar to other respiratory genes (ADH2, COX13, NDI1, NDE1)

  • Mitochondrial function analysis:

    • Assess respiratory capacity in YOR225W knockout strains

    • Measure mitochondrial membrane potential

    • Analyze TCA cycle intermediate concentrations

    • Evaluate electron transport chain activity

  • Petite phenotype characterization:

    • Determine if YOR225W affects petite formation frequency

    • Compare growth of YOR225W mutants on fermentable vs. non-fermentable carbon sources

    • Assess if YOR225W is essential for respiratory growth

  • Metabolic adaptation studies:

    • Monitor transition from fermentative to respiratory metabolism in YOR225W mutants

    • Analyze diauxic shift kinetics and gene expression changes

    • Determine if YOR225W affects the induction of HXK1, which is upregulated during growth on non-fermentable carbon sources

This methodological approach builds on observations that respiratory deficient petite mutants show altered ethanol production and carbon source utilization patterns .

How does the structure of YOR225W relate to its potential function?

Understanding the relationship between YOR225W's structure and function requires computational and experimental structural biology approaches:

  • Computational structure prediction:

    • Use AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Perform homology modeling if structural homologs exist

    • Identify potential functional domains and active sites

    • Predict protein-protein interaction interfaces

  • Experimental structure determination:

    • Express and purify protein for X-ray crystallography

    • Use NMR spectroscopy for dynamic structural information

    • Apply cryo-EM for larger complexes or membrane-associated forms

    • Perform limited proteolysis to identify structured domains

  • Structure-function relationship studies:

    • Create point mutations in predicted functional residues

    • Perform alanine scanning of conserved regions

    • Design truncation constructs to isolate functional domains

    • Assess effects of mutations on protein activity and interactions

  • Molecular dynamics simulations:

    • Model protein behavior in different cellular environments

    • Predict conformational changes upon binding to partners

    • Identify potential ligand binding sites

These approaches integrate computational prediction with experimental validation to develop mechanistic insights into YOR225W function.

What phenotypic effects are observed in YOR225W deletion strains?

Characterizing phenotypic effects of YOR225W deletion provides clues to its function:

  • Growth phenotype analysis:

    • Measure growth rates in various media compositions

    • Test carbon source utilization patterns (glucose, xylose, glycerol, ethanol)

    • Monitor growth under different stress conditions (oxidative, temperature, pH)

    • Analyze cellular morphology for abnormalities

  • Metabolic profiling:

    • Measure key metabolite concentrations using targeted metabolomics

    • Analyze fermentation products (ethanol, xylitol) under different conditions

    • Compare respiratory quotient (CO2 production vs. O2 consumption)

    • Assess energy charge and redox balance indicators (NAD+/NADH ratio)

  • Global physiological responses:

    • Perform transcriptome analysis to identify compensatory mechanisms

    • Analyze proteome changes in response to gene deletion

    • Compare phenotypes with known genes involved in related pathways

    • Test genetic interactions with respiratory and metabolic genes

  • Stress response characterization:

    • Assess oxidative stress tolerance

    • Measure cell survival under nutrient limitation

    • Analyze heat shock response

    • Test resistance to various chemicals and drugs

This comprehensive phenotyping approach can reveal both direct and indirect effects of YOR225W deletion, similar to methods used to characterize other yeast proteins involved in metabolism and stress response .

How can researchers determine if YOR225W affects gene expression of metabolic pathways?

To investigate YOR225W's potential role in regulating metabolic pathways:

  • Transcriptome analysis in deletion strains:

    • Perform RNA-seq comparing ΔyYOR225W to wild-type under multiple conditions

    • Focus on differential expression of glycolytic, TCA cycle, and respiratory genes

    • Analyze changes in pentose phosphate pathway gene expression

    • Compare results with expression patterns seen in xylose metabolism studies

  • Chromatin immunoprecipitation studies:

    • Perform ChIP-seq with tagged YOR225W to identify potential DNA binding sites

    • Analyze enrichment near promoters of metabolic genes

    • Integrate with known transcription factor binding sites

  • Reporter gene assays:

    • Construct reporter plasmids with promoters of interest

    • Compare reporter activity in presence/absence of YOR225W

    • Test responsiveness to different carbon sources and oxygen levels

  • Protein binding studies:

    • Investigate interactions with known transcriptional regulators

    • Test binding to components of HAP complex or other metabolic regulators

    • Analyze colocalization with transcriptional machinery

These approaches can reveal whether YOR225W functions as a direct regulator of gene expression or indirectly affects metabolic pathways through protein-protein interactions .

What role might YOR225W play in cellular response to environmental stresses?

Investigating YOR225W's potential role in stress response:

  • Stress condition expression profiling:

    • Monitor YOR225W expression under different stresses (oxidative, osmotic, temperature)

    • Compare with known stress-responsive genes

    • Analyze temporal patterns during adaptation to stress

    • Test dependency on stress-activated signaling pathways

  • Stress tolerance phenotyping:

    • Compare survival rates of wild-type and ΔYOR225W strains under various stresses

    • Measure growth recovery after stress exposure

    • Analyze cellular damage markers (ROS levels, protein carbonylation)

    • Test specific stress responses like unfolded protein response activation

  • Stress signaling pathway interaction:

    • Investigate genetic interactions with stress-activated protein kinases

    • Test dependency on stress-responsive transcription factors (Msn2/4, Yap1)

    • Analyze phosphorylation status of YOR225W under stress conditions

    • Determine subcellular relocalization during stress

  • Comparative analysis with known stress response proteins:

    • Compare phenotypic profiles with other stress-responsive genes

    • Analyze physical interactions with stress response machinery

    • Test functional complementation with homologs from other organisms

This systematic approach can reveal potential roles for YOR225W in specific stress response pathways, similar to methods used for characterizing other yeast stress response proteins .

What homologs of YOR225W exist in other species and what can they tell us about its function?

Comparative genomic analysis of YOR225W can provide evolutionary context and functional clues:

  • Homolog identification:

    • Perform BLAST and HMM searches against diverse genomic databases

    • Identify orthologs in other yeast species and related fungi

    • Search for distant homologs in other eukaryotes

    • Analyze conservation patterns across evolutionary lineages

  • Sequence conservation analysis:

    • Generate multiple sequence alignments of identified homologs

    • Identify highly conserved residues and motifs

    • Analyze selection pressure across different regions (dN/dS ratios)

    • Map conservation onto predicted structural models

  • Functional information transfer:

    • Compile known functions of characterized homologs

    • Identify experimentally validated functional residues in homologs

    • Analyze domain architecture conservation and variation

    • Assess if homologs have been characterized in xylose metabolism or stress response

  • Integrative analysis:

    • Construct phylogenetic trees to understand evolutionary relationships

    • Correlate function with sequence/structure conservation patterns

    • Identify co-evolution with interacting partners

    • Test functional complementation with homologs from other species

This approach leverages evolutionary conservation to provide insights into protein function, similar to methods used in studying other conserved but uncharacterized yeast proteins .

How can researchers apply findings from characterized S. cerevisiae strains to understand YOR225W?

Leveraging knowledge from characterized S. cerevisiae strains:

  • Comparative strain analysis:

    • Compare YOR225W sequence and expression across different S. cerevisiae strains

    • Analyze natural variants and polymorphisms in clinical and environmental isolates

    • Correlate sequence variations with phenotypic differences

    • Examine strains with different metabolic capabilities, such as YP4 and YH1

  • Strain-specific expression patterns:

    • Compare YOR225W expression levels across different genetic backgrounds

    • Analyze expression in strains with different metabolic properties

    • Examine correlation with respiratory vs. fermentative preferences

    • Look for strain-specific regulatory elements in promoter regions

  • Genetic background effects:

    • Introduce YOR225W mutations into different strain backgrounds

    • Assess phenotypic effects across diverse genetic contexts

    • Identify genetic modifiers that influence YOR225W function

    • Test for strain-specific genetic interactions

  • Integration with population genomics:

    • Analyze YOR225W in the context of S. cerevisiae population structure

    • Identify variants associated with specific ecological niches

    • Compare industrial, clinical, and environmental isolates

    • Assess if YOR225W shows patterns similar to genes in the HG2 or HG3 clusters

This approach leverages natural variation and strain diversity to understand protein function in different genetic and environmental contexts .

What insights can bioinformatic analysis provide about YOR225W domain architecture and functional predictions?

Comprehensive bioinformatic analysis of YOR225W can reveal functional domains and mechanisms:

  • Domain architecture analysis:

    • Search against domain databases (Pfam, InterPro, SMART)

    • Identify conserved motifs and functional sites

    • Predict transmembrane regions or signal peptides

    • Analyze intrinsically disordered regions

  • Structural feature prediction:

    • Predict secondary structure elements

    • Identify potential binding pockets or catalytic sites

    • Analyze surface properties (hydrophobicity, electrostatic potential)

    • Predict post-translational modification sites

  • Functional inference through computational methods:

    • Perform gene neighborhood analysis

    • Analyze gene co-expression networks

    • Search for shared regulatory elements with functionally related genes

    • Apply machine learning approaches trained on known protein functions

  • Integration with experimental data:

    • Map high-throughput data (protein interactions, genetic screens) onto sequence

    • Correlate sequence features with experimental phenotypes

    • Identify regions for targeted mutagenesis

    • Design experiments to test computational predictions

This integrated computational approach generates testable hypotheses about protein function based on sequence and structural features, guiding experimental design for functional characterization .

What controls should be included when studying YOR225W expression and function?

Proper experimental controls are critical for reliable characterization of YOR225W:

  • Expression analysis controls:

    • Include housekeeping genes as reference for normalization (ACT1, TDH3)

    • Compare with genes known to respond similarly to experimental conditions

    • Include positive controls for carbon source response (HXK1 for non-fermentable sources)

    • Validate results using multiple methods (RT-PCR, RNA-seq, Northern blot)

  • Protein function controls:

    • Include wild-type strain in all phenotypic assays

    • Use strains with deletions in related pathways as comparative controls

    • Complement deletion with wild-type gene to confirm phenotype causality

    • Include strains with known respiratory deficiencies (petite, ρ°) when studying metabolism

  • Interaction analysis controls:

    • Include known interacting protein pairs as positive controls

    • Use unrelated proteins as negative controls

    • Test for non-specific binding with tag-only constructs

    • Validate key interactions through multiple methods

  • Growth condition standardization:

    • Maintain consistent media composition across experiments

    • Standardize inoculation density and growth phase for harvesting

    • Control oxygen levels precisely when comparing respiratory conditions

    • Document detailed growth parameters in all experiments

These methodological controls ensure reproducibility and reliability of results, following established practices in yeast functional genomics research .

How can researchers effectively distinguish direct and indirect effects when characterizing YOR225W?

Distinguishing direct from indirect effects requires methodological rigor:

  • Temporal analysis:

    • Perform time-course experiments after perturbation

    • Identify immediate versus delayed responses

    • Use inducible expression systems for controlled activation

    • Apply mathematical modeling to infer causality from temporal data

  • Biochemical validation:

    • Test direct physical interactions in vitro with purified components

    • Perform enzyme assays to confirm catalytic activities

    • Use site-directed mutagenesis to disrupt specific functions

    • Apply structural biology approaches to characterize binding interfaces

  • Genetic dissection:

    • Construct point mutations affecting specific functions

    • Use suppressor screens to identify genes that rescue phenotypes

    • Create separation-of-function alleles to distinguish between activities

    • Employ epistasis analysis to order gene functions in pathways

  • Systems-level approaches:

    • Integrate multi-omics data (transcriptomics, proteomics, metabolomics)

    • Apply network analysis to distinguish direct targets from downstream effects

    • Use conditional dependencies to map functional relationships

    • Develop predictive models and test with targeted experiments

This systematic approach helps establish causal relationships and distinguish primary functions from secondary effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.