Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL044C (YPL044C)

What is YPL044C and why is it classified as a putative uncharacterized protein?

YPL044C is a protein encoded by the YPL044C gene in Saccharomyces cerevisiae (baker's yeast), specifically identified in the reference strain ATCC 204508/S288c . It is classified as "putative uncharacterized" because while its sequence has been determined through genomic sequencing efforts, its biological function remains largely unknown.

The protein consists of 182 amino acids with the sequence: MVASTTVPYLPKIFFNLTGSRQLHGIFLIINFGLPFSMESSPSASSSSSLFWPVIFSDDS GVLFSTTSDVFFERSLLLAMSTLKICPLNLVFLALARASFVSSSTAKLTNPKPLDLLFVS LTTTACLIGAKLEKKSASCSSVTSWGIDLTNKVFISRPSSFCFETLLEGTSTFSIVSSIS LW . This sequence has been cataloged in protein databases such as UniProt (O13520), but experimental validation of its function has been limited.

The "putative" designation indicates that while bioinformatic analyses may suggest potential functions based on sequence motifs or structural predictions, these have not been experimentally confirmed. Understanding uncharacterized proteins like YPL044C is crucial for completing our knowledge of yeast cellular processes and potentially discovering novel biological functions.

What structural features and domains characterize the YPL044C protein?

Based on sequence analysis of YPL044C, the protein appears to have several hydrophobic regions that may suggest membrane association. The full 182-amino acid sequence reveals patterns consistent with transmembrane domains, though these would require experimental verification .

Several computational approaches can be employed to predict secondary structures:

Detailed structural characterization would require experimental methods such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy, none of which appear to have been reported for YPL044C in the available literature.

How can researchers design effective experimental approaches to characterize the function of YPL044C?

Characterizing uncharacterized proteins like YPL044C requires a multi-faceted approach combining genetic, biochemical, and computational methods. Based on approaches used for similar proteins, researchers can implement the following experimental design:

• Genetic Approaches:

  • Gene deletion or knockout studies to observe phenotypic changes

  • Overexpression studies to identify gain-of-function phenotypes

  • Complementation assays to test for functional homology with known proteins

  • Systematic genetic interaction mapping using techniques like synthetic genetic array (SGA) analysis

• Biochemical and Molecular Approaches:

  • Recombinant protein expression and purification for in vitro studies

  • Antibody generation for immunoprecipitation and localization studies

  • Pull-down assays to identify protein interaction partners

  • Activity assays based on predicted functions

• High-throughput Approaches:

  • ChIP-exo methodology if YPL044C is suspected to be a DNA-binding protein, similar to approaches used for transcription factor identification

  • Barcoded allele libraries to test functional variations across natural isolates

  • Multiplexed assays to screen multiple conditions simultaneously

A systematic approach would first establish expression conditions, followed by localization studies, interaction mapping, and finally specific functional assays guided by the accumulated data.

How might computational prediction methods help understand the potential function of YPL044C?

Computational prediction methods offer powerful approaches for generating hypotheses about uncharacterized proteins like YPL044C. Several computational strategies can provide insights:

• Sequence Homology Analysis: While YPL044C is uncharacterized, distant homologs with known functions may exist in other species. Using sensitive sequence comparison tools like PSI-BLAST, HHpred, or HMMER can detect remote homologies .

• Structural Prediction: Homology modeling approaches like those used for transcription factors can generate structural models of YPL044C . The SWISS-MODEL pipeline described in the literature can predict three-dimensional structures based on similar proteins with known structures .

• Functional Prediction Algorithms: Machine learning approaches like TFpredict (which has been adapted for use with bacterial genomes) could be modified for yeast proteins to predict potential functions . This algorithm typically scores proteins based on sequence features associated with specific functions.

• Network-Based Approaches: Integration of protein-protein interaction data, co-expression networks, and genetic interaction data can place YPL044C within functional modules, suggesting its role by association.

A comprehensive functional prediction workflow might involve:

These predictions would generate testable hypotheses to guide experimental characterization of YPL044C.

What challenges exist in expressing and purifying recombinant YPL044C for structural and functional studies?

Recombinant expression and purification of YPL044C presents several technical challenges that researchers should consider:

• Expression System Selection: While homologous expression in S. cerevisiae might preserve native folding and modifications, heterologous systems like E. coli often yield higher protein quantities. The search results indicate that recombinant YPL044C has been successfully produced, though specific challenges are not detailed .

• Protein Solubility: If YPL044C contains hydrophobic regions or transmembrane domains as suggested by its sequence, it may have solubility issues. Researchers might need to:

  • Use detergents for extraction and stabilization

  • Express truncated constructs excluding hydrophobic regions

  • Employ fusion partners like MBP or SUMO to enhance solubility

• Purification Strategy: The recombinant YPL044C described in the search results is mentioned with a tag, though the specific tag type "will be determined during production process" . Common approaches include:

  • Affinity chromatography (His-tag, GST-tag)

  • Ion exchange chromatography

  • Size exclusion chromatography for final polishing

• Protein Stability: The commercial preparation of YPL044C is stored in "Tris-based buffer, 50% glycerol, optimized for this protein" , suggesting stability concerns. Researchers should consider:

  • Buffer optimization screens

  • Addition of stabilizing agents

  • Storage at -20°C or -80°C to prevent degradation

  • Avoiding repeated freeze-thaw cycles

A methodical approach to overcome these challenges would involve parallel testing of multiple expression constructs, host systems, and purification strategies to identify optimal conditions for obtaining functional protein for downstream analyses.

How can researchers investigate potential interactions between YPL044C and other cellular components?

Investigating protein-protein interactions and other cellular component interactions is crucial for understanding YPL044C's function. Several complementary approaches can be employed:

• Affinity Purification Mass Spectrometry (AP-MS):

  • Tag YPL044C with affinity tags like FLAG, HA, or TAP

  • Perform pull-downs under different cellular conditions

  • Identify interacting proteins via mass spectrometry

  • Validate key interactions with co-immunoprecipitation and Western blotting

• Yeast Two-Hybrid (Y2H) Screening:

  • Use YPL044C as bait to screen yeast genomic or cDNA libraries

  • Identify binary protein interactions

  • Validate with alternative methods to exclude false positives

• Proximity Labeling Methods:

  • Fuse YPL044C to enzymes like BioID or APEX2

  • Label proximal proteins in living cells

  • Identify labeled proteins through mass spectrometry

• Genetic Interaction Mapping:

  • Synthetic Genetic Array (SGA) analysis to identify genetic interactions

  • Chemical-genetic profiling to identify pathway connections

• If DNA Interactions Are Suspected:

  • ChIP-exo methodology, similar to that described for bacterial transcription factors

  • DNA affinity purification sequencing (DAP-seq)

  • Electrophoretic mobility shift assays (EMSAs)

These approaches should be combined with systematic data analysis to identify high-confidence interactions and place YPL044C within cellular pathways.

How do YPL044C variants across different S. cerevisiae strains impact function?

Natural variation in YPL044C across S. cerevisiae strains may provide insights into its functional constraints and adaptability. Researchers can employ approaches similar to those described for other yeast genes like SUL1 :

• Variant Collection and Analysis:

  • Collect YPL044C sequences from diverse yeast isolates

  • Clone and barcode all alleles en masse from natural isolates

  • Use long-read sequencing (like PacBio) to match barcodes with variants

  • Analyze polymorphism patterns to identify conserved versus variable regions

• Functional Assessment of Variants:

  • Transform reference strains with the variant library

  • Use barcode sequencing to track fitness effects of each allele under different conditions

  • Stratify functional and nonfunctional alleles based on fitness measurements

• Structure-Function Correlation:

  • Map polymorphisms to predicted structural features

  • Identify which coding and noncoding region polymorphisms affect function

  • Pinpoint detrimental mutations versus those with small or intermediate effects

• Evolutionary Analysis:

  • Integrate results with phylogenetic data

  • Determine how often loss-of-function occurs across the evolutionary history

  • Identify patterns of selection acting on YPL044C

This approach would provide a comprehensive view of YPL044C's functional constraints and potential adaptive roles across different ecological niches and evolutionary lineages of S. cerevisiae.

What can comparative genomics reveal about the evolutionary conservation and potential function of YPL044C?

Comparative genomics approaches can provide valuable insights into YPL044C's evolutionary history and functional importance:

• Ortholog Identification:

  • Search for YPL044C orthologs across fungal species

  • Extend search to more distant taxonomic groups if initial searches yield results

  • Analyze patterns of presence/absence across species

• Sequence Conservation Analysis:

  • Multiple sequence alignment of identified orthologs

  • Calculation of conservation scores for each position

  • Identification of highly conserved regions likely crucial for function

  • Analysis of selection patterns (dN/dS ratios) to identify positions under purifying or positive selection

• Synteny Analysis:

  • Examine genomic context of YPL044C orthologs across species

  • Identify conserved gene neighborhoods that might suggest functional relationships

• Domain Architecture Comparison:

  • Compare domain organizations across orthologs

  • Identify conserved versus lineage-specific features

A systematic analysis would look for patterns like:

These evolutionary patterns could guide experimental focus to the most functionally relevant regions of YPL044C.

What are the optimal protocols for detecting YPL044C expression at the protein level?

Detecting YPL044C at the protein level requires careful consideration of methods suited to potentially low-abundance proteins:

• Antibody-Based Detection:

  • Western blotting with optimized extraction methods for potentially membrane-associated proteins

  • Immunoprecipitation to concentrate protein before detection

  • Immunofluorescence microscopy for localization studies

• Mass Spectrometry-Based Detection:

  • Targeted proteomics approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM)

  • Sample fractionation to reduce complexity and enhance detection of low-abundance proteins

  • SILAC or TMT labeling for quantitative comparisons across conditions

• Tagged Protein Approaches:

  • C- or N-terminal tagging of endogenous YPL044C with epitope tags or fluorescent proteins

  • Consideration of tag position to minimize functional interference

  • Validation that tagging doesn't disrupt localization or function

• Protein Expression Optimization:

  • Testing different growth conditions and stress treatments to identify conditions that upregulate YPL044C

  • Use of strong inducible promoters for controlled overexpression

  • Subcellular fractionation to concentrate protein from relevant compartments

When working with the commercially available recombinant YPL044C described in search result , researchers should follow the recommended storage conditions (store at -20°C or -80°C for extended storage) and avoid repeated freezing and thawing, as indicated in the product information .

How can ChIP-exo and related techniques be applied to understand YPL044C's potential role as a transcription factor?

If YPL044C is suspected to function as a transcription factor or DNA-binding protein, chromatin immunoprecipitation followed by exonuclease digestion (ChIP-exo) provides high-resolution mapping of protein-DNA interactions. Based on approaches described for other transcription factors , researchers could:

• ChIP-exo Experimental Design:

  • Generate strains expressing epitope-tagged YPL044C (e.g., myc tag)

  • Perform chromatin immunoprecipitation with specific antibodies

  • Apply exonuclease treatment to increase resolution of binding sites

  • Sequence and map binding locations genome-wide

• Multiplexed Approach for Efficiency:

  • Use barcoded adapters to multiplex samples

  • Pool samples after the first adapter ligation

  • Process the pooled samples through remaining enzymatic reactions

  • Demultiplex data based on unique 6-base barcodes

• Binding Motif Analysis:

  • Extract sequences from binding regions

  • Perform motif discovery using tools like MEME

  • Compare identified motifs with known transcription factor binding sites

• Functional Analysis of Bound Genes:

  • Categorize target genes according to Clusters of Orthologous Groups (COG)

  • Perform functional enrichment analysis using hypergeometric tests

  • Identify significantly enriched functional categories (p-value < 0.01)

• Integration with Expression Data:

  • Perform RNA-seq in wild-type and YPL044C mutant strains

  • Calculate differentially expressed genes using DESeq2

  • Correlate binding data with expression changes to identify direct regulatory targets

This approach would provide comprehensive insights into YPL044C's potential role in transcriptional regulation and identify its target genes and biological processes.

How might characterization of YPL044C contribute to our understanding of yeast biology?

Characterizing YPL044C has potential to advance several areas of yeast biology:

• Genome Annotation Completion:

  • Functional characterization would help complete the annotation of the S. cerevisiae genome

  • Approximately 1000 yeast genes remain uncharacterized or poorly characterized

  • Each characterized gene fills knowledge gaps in metabolic and regulatory networks

• Novel Biological Processes Discovery:

  • Uncharacterized proteins often represent undiscovered biological processes

  • YPL044C might be involved in stress responses, cellular adaptation, or specialized metabolic pathways

  • Its characterization could reveal new aspects of yeast physiology

• Evolutionary Insights:

  • Understanding the function and conservation of YPL044C across fungal species

  • Insights into the evolution of cellular processes in eukaryotes

  • Potential identification of lineage-specific adaptations

• Systems Biology Integration:

  • Placing YPL044C within the context of known cellular networks

  • Improving predictive models of cell behavior

  • Identifying new regulatory connections or metabolic pathways

• Biotechnological Applications:

  • If YPL044C proves to have functions relevant to industrial processes, it could inform strain engineering

  • Potential applications in metabolic engineering if involved in biosynthetic pathways

  • Possible targets for improving stress tolerance in industrial strains

The research approach used for YPL044C characterization could also serve as a model for studying other uncharacterized proteins, advancing methodologies for functional genomics.

What are the challenges in interpreting contradictory experimental results about YPL044C function?

Researchers often encounter contradictory results when characterizing previously uncharacterized proteins like YPL044C. Several methodological approaches can help resolve such contradictions:

• Experimental Condition Variability:

  • Carefully control and document growth conditions, strain backgrounds, and experimental parameters

  • Systematically test functions under diverse conditions as protein function may be condition-specific

  • Develop standardized protocols that can be reproduced across laboratories

• Strain Background Effects:

  • Test functions in multiple strain backgrounds, as genetic interactions may affect phenotypes

  • Consider the approach used in studies of natural variants where strain background is systematically varied

  • Document genetic differences between strains used in different studies

• Technical Approach Limitations:

  • Each method has inherent biases and limitations

  • Employ orthogonal techniques to verify findings

  • Consider both loss-of-function and gain-of-function approaches

• Data Integration Framework:

  • Develop a formal framework for weighing evidence from different experimental approaches

  • Assign confidence scores to different types of evidence

  • Use statistical methods to integrate diverse data types

• Collaborative Validation:

  • Establish collaborations for independent validation of key findings

  • Participate in community efforts to characterize sets of uncharacterized proteins

  • Share reagents, strains, and protocols to ensure reproducibility

When facing contradictory results, researchers should consider:

By systematically addressing contradictions, researchers can develop a more nuanced understanding of YPL044C's function.