Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL114W (YPL114W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
YPL114W; Putative uncharacterized protein YPL114W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPL114W
Target Protein Sequence
MVQLSTYLPSPPSTNMSCTFSSVMSVCFMTMSATVLPICGKAVTSHLRSNSCLTRVSSFL NTSRPQLATFPDSRASSSTSSSMHVPLPTLTILTPSLHQAKLLRLIILFVEAVLGKAKMI KSAFFQVFGSSRSEWYLAL
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the known structural characteristics of the YPL114W protein?

YPL114W is a putative uncharacterized protein from Saccharomyces cerevisiae consisting of 139 amino acids. Current recombinant versions are available as His-tagged proteins expressed in E. coli systems . Due to its uncharacterized nature, detailed structural information remains limited.

For structural characterization, researchers should consider:

  • Bioinformatic analysis using homology modeling and sequence alignment with related yeast proteins

  • Expression and purification of the recombinant protein using the His-tag for affinity purification

  • Application of circular dichroism (CD) spectroscopy to determine secondary structure elements

  • X-ray crystallography or NMR spectroscopy for high-resolution structural determination if initial analyses indicate novel structural features

  • Limited proteolysis to identify stable domains within the protein

The primary research focus should be on obtaining sufficient quantities of purified protein for these analyses by optimizing expression conditions in E. coli or alternative expression systems.

How can I design efficient gene deletion experiments to study YPL114W function?

To effectively delete YPL114W for functional studies, a homologous recombination approach is recommended. This requires:

  • Design of PCR primers containing 40-50bp homology to regions flanking the YPL114W gene with additional sequences for amplifying a selectable marker

  • Transformation of competent yeast cells using the lithium acetate method with your PCR-amplified deletion cassette

  • Selection of transformants on appropriate media

The protocol should follow these key steps:

  • Harvest yeast cells at optimal density (1-2 × 10^7 cells/mL with OD600 of 0.1-0.2)

  • Prepare cells by washing and resuspending in lithium acetate

  • Perform transformation with the deletion cassette

  • Plate on selective media to identify successful transformants

  • Confirm gene deletion by PCR verification

For improved transformation efficiency, ensure cells are harvested at the early log phase and use freshly prepared competent cells. Control transformations lacking DNA should be included to monitor background growth on selective media.

What expression systems are most suitable for producing recombinant YPL114W protein?

While E. coli is currently used for recombinant YPL114W expression , researchers should consider multiple expression systems based on experimental needs:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid growth, cost-effectiveLacks eukaryotic post-translational modificationsInitial structural studies, antibody generation
S. cerevisiaeNative post-translational modifications, proper foldingLower yield than E. coliFunctional studies requiring authentic modifications
Pichia pastorisHigh density culture, eukaryotic modificationsLonger development timeLarge-scale production with native-like processing
Mammalian cellsComplex eukaryotic modificationsExpensive, low yieldInteraction studies with mammalian partners

For initial characterization, E. coli expression with the His-tag system provides sufficient protein for preliminary studies . For functional studies, consider using the native S. cerevisiae system with either constitutive or inducible promoters to maintain the protein's natural environment.

How should I interpret contradictory data when characterizing the function of YPL114W?

When faced with contradictory results during YPL114W characterization, a systematic analytical approach is essential:

  • Thoroughly examine your data, paying special attention to outliers that may influence results

  • Compare your findings with available literature, even if limited for this uncharacterized protein

  • Evaluate initial assumptions and experimental design for potential sources of discrepancy

  • Consider alternative hypotheses that might explain seemingly contradictory observations

The interpretive process should involve:

  • Creating a comprehensive data examination table listing all observed discrepancies

  • Analyzing experimental variables that might contribute to contradictions

  • Implementing additional controls to test specific aspects of conflicting results

  • Considering whether the contradictions themselves reveal important information about YPL114W's complex function

When working with uncharacterized proteins like YPL114W, contradictory results often reflect the discovery of novel functions rather than experimental errors. Document all observations meticulously, as apparent contradictions may lead to breakthrough insights into the protein's biological role .

What synthetic recombinant population approaches are most effective for studying YPL114W genetic interactions?

For comprehensive genetic interaction studies of YPL114W, synthetic recombinant populations offer powerful analytical capabilities. Two main approaches should be considered:

  • K-type population construction: Involves random mating of multiple founder strains

  • S-type population construction: Utilizes careful crossing designs where founding lines are crossed in specific patterns (pairs or round-robin)

The S-type approach offers several advantages for studying YPL114W interactions:

  • Better representation of founder genotypes

  • More controlled recombination patterns

  • Enhanced ability to track genetic markers through multiple generations

The methodology involves:

  • Pairing haploid strains of opposite mating types

  • Isolating successful diploid colonies

  • Inducing sporulation in potassium acetate media

  • Collecting and validating meiotic products

  • Implementing multiple outcrossing cycles (typically 12 cycles)

For analyzing genetic interactions, genome sequencing should be performed at key timepoints (initial, cycle 6, and cycle 12) to track recombination patterns and identify potential interactions with YPL114W .

What approaches can overcome the lack of expression data for YPL114W?

The Saccharomyces Genome Database indicates no expression data is currently available for YPL114W , creating challenges for functional characterization. To address this limitation:

  • Generate custom expression profiles using:

    • RNA-Seq under various environmental conditions

    • Quantitative RT-PCR with primers specific to YPL114W

    • Promoter-reporter fusion constructs to visualize expression patterns

  • Employ SPELL (Serial Pattern of Expression Levels Locator) analysis with:

    • Custom expression datasets from your experiments

    • Correlation analysis to identify genes with similar expression patterns

  • Develop tagged versions of YPL114W for:

    • Fluorescent protein fusions to track localization

    • Epitope tags for immunoprecipitation and ChIP studies

    • Proximity labeling approaches to identify interacting partners

Expression Analysis MethodData GeneratedApplication to YPL114W
RNA-SeqTranscriptome-wide expression levelsIdentify conditions inducing YPL114W expression
qRT-PCRTargeted expression quantificationValidate expression patterns in specific conditions
Western blottingProtein-level expressionConfirm translation and stability of YPL114W
Promoter-GFP fusionsSpatial and temporal expression patternsVisualize when and where YPL114W is expressed

Since YPL114W lacks established expression data, your systematic characterization will significantly contribute to the understanding of this uncharacterized protein.

How can I design experiments to determine if YPL114W participates in specific cellular pathways?

To systematically identify pathways involving YPL114W, implement a multi-faceted approach:

  • Phenotypic screening of YPL114W deletion strains:

    • Test growth under various stress conditions (temperature, pH, osmotic stress)

    • Evaluate sensitivity to chemicals targeting specific pathways

    • Analyze morphological changes using microscopy

  • Genetic interaction mapping:

    • Perform synthetic genetic array (SGA) analysis by crossing YPL114W deletion with genome-wide deletion collection

    • Identify synthetic lethal or synthetic sick interactions

    • Construct double mutants with genes in candidate pathways

  • Protein interaction studies:

    • Implement affinity purification coupled with mass spectrometry

    • Perform yeast two-hybrid screening

    • Use proximity-dependent biotin labeling (BioID) to identify neighboring proteins

  • Transcriptional profiling:

    • Compare gene expression changes in wild-type versus YPL114W deletion strains

    • Identify differentially expressed genes that may be co-regulated

The absence of established pathway information for YPL114W indicates this protein requires fundamental characterization. Begin with broad phenotypic screens before progressing to more targeted approaches based on initial results.

What are the best practices for designing PCR primers for YPL114W manipulation?

When designing primers for YPL114W manipulation, consider these critical parameters:

  • For gene deletion via homologous recombination:

    • Include 40-50bp homology arms matching sequences flanking YPL114W

    • Add appropriate restriction sites for subsequent cloning if needed

    • Ensure adequate GC content (40-60%) in the annealing portion

    • Verify primer specificity against the S. cerevisiae genome

  • For expression construct generation:

    • Include a Kozak consensus sequence for optimal translation

    • Consider codon optimization based on the expression system

    • Add sequences for epitope tags or fusion proteins if required

    • Include appropriate restriction sites compatible with your vector

  • For site-directed mutagenesis:

    • Position mutations centrally within primers

    • Ensure at least 10-15 bases of correct sequence on each side of the mutation

    • Verify similar melting temperatures between forward and reverse primers

The success of your YPL114W manipulation depends significantly on primer design quality. Always validate primers using in silico PCR before ordering and sequence verify all constructs before proceeding with functional experiments.

How should I approach contradictions between bioinformatic predictions and experimental results for YPL114W?

When bioinformatic predictions clash with experimental findings for YPL114W:

  • Evaluate prediction limitations:

    • Assess confidence scores of the prediction algorithms

    • Consider whether the algorithms were trained on data relevant to yeast proteins

    • Determine if structural homology exists with better-characterized proteins

  • Review experimental design:

    • Examine whether experimental conditions match the physiological context

    • Implement additional controls to rule out technical artifacts

    • Consider whether the chosen assays appropriately test the predicted function

  • Reconciliation strategies:

    • Design experiments specifically targeting the discrepancy

    • Consider whether the protein has multiple functions

    • Test if experimental conditions affect protein behavior

  • Documentation and reporting:

    • Thoroughly document both predicted and experimental findings

    • Report contradictions transparently in publications

    • Propose models that might explain the discrepancies

Since YPL114W is uncharacterized, your experimental results may provide the first reliable functional data, potentially superseding purely computational predictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.