Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL238C (YPL238C)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPL238C (YPL238C) is a protein derived from the yeast Saccharomyces cerevisiae. It is also known as Putative uncharacterized protein YPL238C . Proteins in this category are often identified through genomic studies, but their specific functions have not been fully elucidated through experimentation.

Basic Characteristics

CharacteristicDescription
OrganismSaccharomyces cerevisiae (Baker's yeast)
Alternative NamesPutative uncharacterized protein YPL238C
Purity≥ 85% as determined by SDS-PAGE
Expression HostCell-Free Expression system, E. coli, Yeast, Baculovirus, or Mammalian Cells

Function and Role

YPL238C is involved in modulating mitochondrial function and cellular aging . Deletion of the YBR238C gene, a similar gene, increases cellular lifespan by enhancing mitochondrial function, while its overexpression accelerates cellular aging via mitochondrial dysfunction . The phenotypic effect of YBR238C is largely explained by HAP4- and RMD9-dependent mechanisms .

YBR238C is an effector of TORC1 that modulates mitochondrial function . Mitochondrial dysfunction induces TORC1 activity, enhancing cellular aging, and TORC1 inhibition by rapamycin improves the shortened lifespan under mitochondrial dysfunction conditions in yeast and human cells .

Impact on Lifespan

Studies show that deletion of YBR238C increases both chronological lifespan (CLS) and replicative lifespan (RLS) in Saccharomyces cerevisiae . Transcriptome analysis of the ybr238c∆ mutant showed significant differences from the wild type, with 326 genes upregulated and 61 genes downregulated .

Involvement in Protein Complexes

YPL238C is found in comprehensive catalogues of yeast protein complexes resulting from systematic curation efforts . These catalogues serve as reference sets for biologists interested in discovering protein interactions and protein complexes .

Availability

Recombinant YPL238C protein and related antibodies are available for research purposes from various suppliers . These products are often used in ELISA and Western blot applications .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPL238C; P1051; Putative uncharacterized protein YPL238C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPL238C
Target Protein Sequence
MLELALGVPSLLSASTLSRPALASSFSNASTLLSFVFFFFFFKDSSPKASAMSSVGSFSA SASAETLLDFFFFFFNPANKSSPEPFSLPFTAASKSSGITFLVFFFFFSAGSNPNSAAKS EDISCVLII
Uniprot No.

Target Background

Database Links

STRING: 4932.YPL238C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YPL238C and why is it significant in yeast genetics?

YPL238C is a putative uncharacterized protein in the yeast genome Saccharomyces cerevisiae. It has been identified through computational gene recognition algorithms that can predict protein-coding genes in yeast with over 95% accuracy . The significance of YPL238C lies in its potential role in genome stability, as it appears in datasets of diploid-specific genome stability genes . Additionally, it has been implicated in stress response mechanisms based on studies of acquired stress resistance in yeast .

Studying uncharacterized proteins like YPL238C is crucial for several reasons:

  • They represent significant knowledge gaps in our understanding of yeast cellular systems

  • They may perform novel functions critical to cellular homeostasis

  • They provide insights into evolutionary relationships and conserved mechanisms

  • They can reveal new potential targets for biotechnological applications

How was YPL238C identified, and what do we know about its genomic location?

YPL238C was identified through comprehensive genome sequencing and annotation efforts in Saccharomyces cerevisiae. The designation "YPL" indicates its location on chromosome XVI, with "P" representing the chromosome and "L" indicating the left arm of the chromosome. The numerical portion "238" represents its relative position on that chromosomal arm, while "C" indicates that it is transcribed from the Crick (complementary) strand.

The identification was accomplished through:

  • Open reading frame (ORF) prediction algorithms

  • Z-curve analysis, which has proven highly effective for protein-coding gene recognition in yeast

  • Comparative genomics with other yeast species

  • Transcriptional evidence for gene expression

YPL238C appears in systematic functional genomics studies focused on stress resistance and genome stability , suggesting it encodes a functional protein despite lacking full characterization.

What approaches are used to predict potential functions of uncharacterized proteins like YPL238C?

Researchers employ several complementary approaches to predict functions of uncharacterized proteins like YPL238C:

  • Computational prediction methods:

    • Sequence homology analysis to identify conserved domains

    • Structural prediction using tools like AlphaFold

    • Gene Ontology (GO) term assignment based on sequence features

    • Protein-protein interaction network analysis

  • Experimental functional genomics:

    • Phenotypic screening of deletion mutants under various conditions

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • Gene expression profiling to determine transcriptional responses

    • Protein localization studies using fluorescently tagged constructs

  • Comparative genomics:

    • Identification of orthologs in other species

    • Conservation analysis to identify functionally important regions

    • Synteny analysis to examine genomic context

YPL238C's appearance in genome stability datasets and stress resistance studies provides initial functional hypotheses that can guide more focused investigations.

How does YPL238C potentially contribute to genome stability in yeast?

YPL238C has been identified in studies of diploid-specific genome stability genes in S. cerevisiae , suggesting a possible role in maintaining genomic integrity. Although its precise function remains uncharacterized, several hypotheses can be formulated based on its inclusion in genome stability datasets:

  • DNA damage response: YPL238C may function in DNA damage sensing, signaling, or repair pathways.

  • Chromosome dynamics: It could play a role in chromosome segregation, cohesion, or condensation during cell division.

  • Replication fidelity: YPL238C might contribute to accurate DNA replication or replication stress responses.

  • Chromatin organization: It may affect chromatin structure, histone modifications, or nucleosome positioning.

To investigate these possibilities, researchers typically employ approaches such as:

  • Measuring mutation rates and chromosomal rearrangements in YPL238C deletion strains

  • Assessing sensitivity to DNA damaging agents

  • Examining synthetic genetic interactions with known genome stability factors

  • Monitoring chromosome segregation using fluorescence microscopy

The table below shows a subset of genome stability genes identified alongside YPL238C in systematic studies:

Gene NameSystematic NameKnown/Predicted Function
PIH1YHR034CR2TP complex component
RBG1YAL036CGTPase
UBP13YBL067CUbiquitin protease
YPL238CYPL238CUncharacterized
NAB6YML117WRNA binding protein
SKG3YLR187WMembrane protein

What evidence suggests YPL238C may be involved in stress response mechanisms?

YPL238C has been implicated in acquired stress resistance mechanisms based on systematic studies using the yeast deletion collection . Several lines of evidence suggest a potential role in stress response:

  • Fitness profiling: YPL238C was identified in screens examining genes required for acquired resistance to hydrogen peroxide (H₂O₂) following pretreatment with mild stresses .

  • Regulatory context: The expression pattern of YPL238C may change under stress conditions, similar to other stress-responsive genes.

  • Signaling pathway connections: YPL238C might function downstream of known stress response pathways such as TOR signaling, which has been linked to stress resistance and was identified in the same screens .

Drawing parallels with other uncharacterized yeast genes that have been subsequently characterized, such as YBR238C (which affects cellular lifespan through mitochondrial function) , YPL238C might similarly play a role in cellular processes that impact stress tolerance.

Experimental approaches to investigate this connection include:

  • Exposing YPL238C deletion strains to various stressors and measuring survival

  • Analyzing transcriptional changes in response to stress

  • Determining if YPL238C physically interacts with known stress response proteins

  • Testing genetic interactions with components of stress signaling pathways like TOR and Ras

How can researchers determine if YPL238C interacts with major regulatory pathways like TORC1?

Determining whether YPL238C interacts with major regulatory pathways such as TORC1 requires multiple complementary approaches:

  • Genetic interaction analysis:

    • Test for synthetic lethality or synthetic rescue between YPL238C and TORC1 components

    • Examine epistatic relationships by creating double mutants

    • Determine if YPL238C deletion affects rapamycin sensitivity, similar to studies with YBR238C

  • Biochemical interaction studies:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Co-immunoprecipitation with TORC1 components

    • Proximity-based labeling methods (BioID, APEX)

  • Pathway output monitoring:

    • Assess phosphorylation status of TORC1 downstream targets in YPL238C mutants

    • Monitor transcriptional changes of TORC1-regulated genes

    • Examine cellular processes controlled by TORC1 (e.g., autophagy, protein synthesis)

  • Response to pathway modulation:

    • Determine if rapamycin treatment affects YPL238C expression or localization

    • Test if YPL238C is required for cellular responses to nutrient limitation

    • Examine if YPL238C deletion affects lifespan extension by TORC1 inhibition

Recent research on the uncharacterized gene YBR238C showed it functions as an effector of TORC1 in modulating mitochondrial function and cellular aging . Using similar approaches could reveal whether YPL238C also participates in TORC1 signaling or other major regulatory pathways.

What experimental techniques are most effective for functional characterization of YPL238C?

Characterizing uncharacterized proteins like YPL238C requires a multifaceted approach combining several techniques:

  • Genetic manipulation strategies:

    • Gene deletion using homologous recombination

    • DAmP (Decreased Abundance by mRNA Perturbation) alleles if the gene is essential

    • CRISPR-Cas9 for precise genome editing

    • Overexpression systems using constitutive or inducible promoters

  • Protein localization and interaction studies:

    • C-terminal/N-terminal epitope tagging (e.g., 3HA tagging)

    • Fluorescent protein fusions for live-cell imaging

    • Immunoprecipitation to identify interaction partners

    • Proximity-dependent labeling to map the protein's microenvironment

  • Phenotypic characterization:

    • Growth assays under various conditions (temperature, nutrients, stressors)

    • Chronological and replicative lifespan analysis

    • Cell morphology and ultrastructure examination

    • Organelle function assessment (especially mitochondria)

  • Global approaches:

    • Transcriptome analysis (RNA-seq) of deletion or overexpression strains

    • Proteome analysis to identify changes in protein abundance

    • Metabolomic profiling to identify metabolic alterations

    • Synthetic genetic array analysis to map genetic interactions

The effectiveness of these approaches depends on the specific aspects of YPL238C function being investigated. Based on its presence in genome stability and stress resistance datasets , experimental designs focusing on these processes would be particularly valuable.

How can deletion mutant analysis reveal the function of YPL238C?

Deletion mutant analysis is a powerful approach for uncovering the function of uncharacterized proteins like YPL238C:

  • Creation of deletion strains:

    • Using homologous recombination to replace YPL238C with a selection marker

    • PCR-based gene deletion strategies as outlined in yeast deletion collection protocols

    • Validating deletion by PCR and sequencing

    • Creating deletion in multiple strain backgrounds to control for genetic interactions

  • Phenotypic characterization:

    • Growth rate analysis under standard and stress conditions

    • Fitness profiling in competitive growth assays

    • Chronological and replicative lifespan assessment

    • Microscopic examination for morphological abnormalities

    • Stress sensitivity testing (oxidative, temperature, osmotic)

  • Molecular phenotyping:

    • Transcriptome analysis using RNA-seq

    • Analysis of mitochondrial function if involved in similar pathways as YBR238C

    • Assessment of genome stability markers

    • Measurement of stress response pathway activation

  • Genetic interaction mapping:

    • Synthetic genetic array analysis

    • Testing specific interactions with genes in pathways of interest

    • Suppressor screens to identify genes that rescue deletion phenotypes

Research on other uncharacterized yeast genes provides a template for this approach. For example, studies of YBR238C revealed its role in regulating cellular lifespan through effects on mitochondrial function, with its deletion increasing lifespan by enhancing mitochondrial function .

What considerations are important when designing protein tagging experiments for YPL238C?

When designing protein tagging experiments for YPL238C, several critical considerations must be addressed:

  • Tag selection:

    • Size and properties of the tag (small epitope tags vs. larger fluorescent proteins)

    • Potential interference with protein function or localization

    • Detection sensitivity required (bright fluorescent proteins for low abundance proteins)

    • Compatibility with planned experimental techniques

  • Tagging position:

    • N-terminal vs. C-terminal tagging based on protein domain organization

    • Internal tagging if terminal regions are critical for function

    • Maintaining native regulatory elements (promoters, terminators)

    • Preserving correct subcellular targeting signals

  • Verification strategies:

    • PCR and sequencing to confirm correct integration

    • Western blotting to verify expression of the fusion protein

    • Functional complementation to ensure the tagged protein retains activity

    • Comparing multiple tagging approaches to control for tag artifacts

  • Integration method:

    • Homologous recombination for genomic integration at the native locus

    • Plasmid-based expression for higher protein levels

    • CRISPR-Cas9 for precise integration with minimal genomic disruption

    • Use of linker sequences to provide flexibility between protein and tag

  • Control experiments:

    • Including untagged wild-type controls

    • Using known proteins with established localization patterns as references

    • Testing in multiple strain backgrounds

    • Validating with alternative detection methods

A specific example of tagging methodology can be found in research on cytoskeleton regulation, where proteins were tagged with 3HA epitopes at their normal chromosomal loci . Similar approaches could be applied to YPL238C to investigate its localization and interactions.

How should researchers interpret contradictory data regarding YPL238C function?

When faced with contradictory data regarding YPL238C function, researchers should implement a systematic approach to resolution:

  • Validation and replication:

    • Independently repeat experiments using the same methodology

    • Confirm results using complementary techniques

    • Verify strain identity and absence of secondary mutations

    • Test in different genetic backgrounds to identify strain-specific effects

  • Reconciliation strategies:

    • Consider context-dependent functions (different roles under different conditions)

    • Examine whether contradictions reflect different aspects of a complex function

    • Investigate whether the protein has multiple distinct activities

    • Analyze timing in dynamic processes (early vs. late effects)

  • Methodological considerations:

    • Evaluate differences in experimental approaches and their limitations

    • Consider sensitivity and specificity of detection methods

    • Assess whether contradictions arise from in vivo vs. in vitro approaches

    • Examine if discrepancies reflect direct vs. indirect effects

  • Integrative analysis:

    • Combine multiple data types to build a comprehensive model

    • Use computational approaches to integrate conflicting datasets

    • Compare with closely related proteins or orthologs

    • Consider evolutionary context and conservation patterns

As observed in ribosome profiling studies, contradictory data can emerge between different experimental approaches , requiring careful integration of multiple lines of evidence to develop an accurate understanding of protein function.

What bioinformatic tools are most useful for analyzing the potential structure and function of YPL238C?

Several bioinformatic tools are particularly valuable for analyzing uncharacterized proteins like YPL238C:

  • Sequence analysis tools:

    • BLAST (Basic Local Alignment Search Tool) for homology identification

    • HMMER for sensitive domain detection using hidden Markov models

    • PSIPRED for secondary structure prediction

    • TMHMM for transmembrane domain prediction

    • SignalP for signal peptide identification

  • Structural prediction:

    • AlphaFold2 for accurate 3D structure prediction

    • RoseTTAFold as an alternative structure prediction method

    • PyMOL for visualization and analysis of predicted structures

    • SWISS-MODEL for homology-based structural modeling

    • MolProbity for structure validation

  • Functional prediction:

    • InterPro for integrated domain and functional site analysis

    • ProtFun for general function prediction

    • PANNZER for protein function annotation

    • ConSurf for identifying functionally important residues based on conservation

    • COFACTOR for enzyme function prediction from structure

  • Yeast-specific resources:

    • Saccharomyces Genome Database (SGD) for genome annotation and functional data

    • YeastMine for integrative data mining

    • FunSpec for functional specification prediction

    • SPELL for expression correlation analysis

    • Z-curve analysis for gene identification, which has proven effective for yeast

  • Network analysis:

    • STRING for protein-protein interaction prediction

    • GeneMANIA for functional network analysis

    • Cytoscape for network visualization and analysis

    • MAGMA for module-based functional prediction

These tools, used in combination, can provide valuable insights into YPL238C's potential structure, function, and relationships with other proteins, guiding experimental investigations.

How can transcriptomic data inform our understanding of YPL238C's role in stress response?

Transcriptomic data can provide valuable insights into YPL238C's potential role in stress response through several analytical approaches:

  • Expression pattern analysis:

    • Examining YPL238C expression changes under various stress conditions

    • Comparing expression profiles across different strains and genetic backgrounds

    • Analyzing temporal expression patterns during stress response

    • Identifying conditions where YPL238C is significantly up- or down-regulated

  • Co-expression network construction:

    • Identifying genes with expression patterns similar to YPL238C

    • Building modules of co-regulated genes

    • Performing gene set enrichment analysis on co-expressed genes

    • Inferring potential functions based on the "guilt by association" principle

  • Differential expression in mutants:

    • Comparing transcriptomes between wild-type and YPL238C deletion strains

    • Identifying pathways dysregulated in YPL238C mutants under stress

    • Examining how YPL238C deletion affects global stress response programs

    • Analyzing whether YPL238C affects expression of known stress response genes

  • Comparative analysis with related genes:

    • Comparing YPL238C expression patterns with those of characterized stress response genes

    • Examining transcriptional responses in mutants of related uncharacterized genes

    • Analyzing expression in the context of major regulators like TORC1

  • Integration with other data types:

    • Combining transcriptomic data with proteomic or metabolomic data

    • Correlating expression changes with phenotypic outcomes

    • Integrating with genetic interaction data from stress response screens

For example, comparative transcriptomic analysis could reveal whether YPL238C deletion affects similar pathways as those identified in studies of YBR238C, which influences cellular lifespan through mitochondrial function and interacts with stress response pathways like TORC1.

What are the best approaches for determining if YPL238C affects cellular lifespan in yeast?

To determine if YPL238C affects cellular lifespan in yeast, researchers should employ a comprehensive set of methodologies:

  • Chronological lifespan (CLS) analysis:

    • Measuring viability of non-dividing yeast cultures over time

    • Using outgrowth assays to quantify surviving cells

    • Applying flow cytometry with viability dyes

    • Testing lifespan under different nutrient conditions

  • Replicative lifespan (RLS) analysis:

    • Counting the number of daughter cells produced by individual mother cells

    • Using micromanipulation to separate daughter cells

    • Employing microfluidic devices for high-throughput analysis

    • Monitoring age-associated phenotypes (e.g., cell size increase)

  • Genetic interaction studies:

    • Creating double mutants with known lifespan regulators

    • Testing epistatic relationships with longevity pathways

    • Examining interactions with nutrient-sensing pathways like TORC1

    • Analyzing the effects of caloric restriction in YPL238C mutants

  • Molecular markers of aging:

    • Measuring reactive oxygen species (ROS) levels

    • Assessing mitochondrial function and morphology

    • Monitoring protein aggregation associated with aging

    • Analyzing telomere length and nuclear morphology

  • Pharmacological interventions:

    • Testing the response to lifespan-extending drugs like rapamycin

    • Comparing the effects of antioxidants

    • Examining the impact of mitochondrial modulators

    • Assessing stress response inducers

These approaches, particularly when combined, can provide robust evidence regarding YPL238C's potential role in lifespan regulation. The study of YBR238C provides an excellent methodological template, as it revealed that this uncharacterized gene affects cellular lifespan through mitochondrial function, with deletion increasing lifespan and overexpression accelerating aging .

How can researchers distinguish between direct and indirect effects of YPL238C deletion?

Distinguishing between direct and indirect effects of YPL238C deletion requires a multi-faceted experimental strategy:

  • Temporal analysis:

    • Implementing time-course experiments to identify primary responses

    • Using rapidly inducible or repressible systems to control YPL238C expression

    • Analyzing immediate versus delayed phenotypes

    • Employing pulse-chase experiments to track molecular changes

  • Biochemical interaction studies:

    • Performing direct binding assays to identify physical interactions

    • Using crosslinking approaches to capture transient interactions

    • Implementing proximity labeling methods to map the immediate environment

    • Conducting in vitro reconstitution experiments

  • Genetic approach:

    • Creating separation-of-function mutants through targeted mutagenesis

    • Employing epistasis analysis to order gene function in pathways

    • Using suppressor screens to identify direct downstream effectors

    • Implementing synthetic genetic array analysis to map the functional network

  • Molecular specificity:

    • Using highly specific inhibitors or activators when available

    • Creating point mutations that affect specific functions

    • Implementing domain-swapping experiments

    • Employing heterologous expression systems

  • Computational analysis:

    • Constructing network models to predict direct versus indirect interactions

    • Implementing Bayesian approaches to infer causal relationships

    • Using machine learning to classify likely direct effects

    • Comparing with datasets from related perturbations

These approaches can help determine whether YPL238C directly affects processes like genome stability and stress response , or if these phenotypes arise indirectly through effects on other cellular systems.

What methodologies can identify the subcellular localization and dynamics of YPL238C?

Determining the subcellular localization and dynamics of YPL238C requires specialized techniques:

  • Fluorescent protein tagging:

    • C-terminal or N-terminal GFP fusion proteins

    • Split-GFP complementation for detecting interactions in specific compartments

    • Photoactivatable or photoswitchable fluorescent proteins for tracking dynamics

    • Multi-color imaging to assess colocalization with organelle markers

  • Advanced microscopy techniques:

    • Confocal microscopy for high-resolution localization

    • Super-resolution microscopy (STED, PALM, STORM) for nanoscale distribution

    • Time-lapse imaging for dynamic behavior

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility assessment

    • Single-particle tracking for detailed movement analysis

  • Biochemical fractionation:

    • Differential centrifugation to separate cellular compartments

    • Gradient centrifugation for refined separation

    • Western blotting of fractions to detect YPL238C

    • Mass spectrometry-based proteomics of purified compartments

  • Proximity-based methods:

    • BioID or TurboID for proximity-dependent labeling

    • APEX2 for electron microscopy-compatible proximity labeling

    • Split-protein complementation assays for interaction-based localization

    • FRET or BRET to detect close proximity to known proteins

  • Dynamic response studies:

    • Tracking localization changes in response to stress conditions

    • Analyzing redistribution during cell cycle progression

    • Monitoring localization changes during aging

    • Examining localization in various mutant backgrounds

Similar methods have been successfully applied in yeast to analyze ER-GFP intensity using specialized software and to study protein aggregation in neurodegenerative disease models , providing templates for YPL238C localization studies.

What are the most promising future research directions for understanding YPL238C function?

Based on current knowledge, several promising research directions could advance our understanding of YPL238C function:

  • Integrated multi-omics analysis:

    • Combining transcriptomics, proteomics, and metabolomics data from YPL238C mutants

    • Implementing systems biology approaches to model YPL238C's role in cellular networks

    • Using computational inference to predict functions from integrated datasets

    • Applying machine learning to identify patterns across multiple data types

  • Mechanistic studies based on existing hints:

    • Investigating the specific role in genome stability suggested by genetic screens

    • Exploring connections to stress response pathways identified in previous studies

    • Examining potential relationships with mitochondrial function, similar to YBR238C

    • Testing interactions with major regulatory pathways like TORC1

  • Evolutionary analysis:

    • Comparing YPL238C function across different yeast species

    • Identifying functional analogs in higher eukaryotes

    • Analyzing selective pressures on YPL238C sequence

    • Investigating potential horizontal gene transfer events

  • High-throughput screening:

    • Performing chemical genetic screens to identify compounds that interact with YPL238C function

    • Using synthetic genetic arrays to comprehensively map genetic interactions

    • Implementing CRISPR screens to identify functional relationships

    • Developing reporter systems to monitor YPL238C activity

  • Application to human disease models:

    • Exploring whether YPL238C affects protein aggregation relevant to neurodegenerative diseases

    • Investigating connections to conserved longevity pathways that impact human aging

    • Testing if YPL238C modulates responses to therapeutic compounds

    • Examining potential roles in stress pathways relevant to human disease

These directions build upon the existing knowledge framework while addressing the key unanswered questions about YPL238C function.

How can contradictions between computational predictions and experimental results for YPL238C be reconciled?

Reconciling contradictions between computational predictions and experimental results for YPL238C requires a systematic approach:

  • Methodological assessment:

    • Evaluating the limitations of computational prediction algorithms

    • Assessing potential biases in experimental approaches

    • Considering the sensitivity and specificity of both methods

    • Examining whether contradictions arise from different underlying assumptions

  • Integrative modeling:

    • Developing models that incorporate both computational and experimental data

    • Weighting evidence based on reliability and relevance

    • Using Bayesian approaches to update predictions with experimental evidence

    • Implementing ensemble methods that combine multiple prediction algorithms

  • Targeted validation experiments:

    • Designing experiments specifically to test computational predictions

    • Using multiple experimental approaches to verify unexpected findings

    • Creating variants with specific mutations to test structure-function predictions

    • Employing orthogonal methods to confirm or refute contradictory results

  • Contextual considerations:

    • Examining if contradictions reflect condition-specific or context-dependent functions

    • Analyzing whether protein interactions modify predicted functions

    • Considering post-translational modifications that might alter function

    • Investigating if contradictions reflect differences between in vivo and in vitro conditions

  • Refinement of prediction methods:

    • Using experimental data to improve computational prediction algorithms

    • Developing yeast-specific prediction tools that account for unique features

    • Incorporating experimental constraints into structural predictions

    • Creating hybrid methods that integrate multiple data types

This approach acknowledges that contradictions between computational predictions and experimental results, as sometimes observed in ribosome profiling data , often reflect the complexity of biological systems and can lead to deeper insights when properly investigated.

What is the potential significance of YPL238C for understanding human disease processes?

Despite being a yeast protein, research on YPL238C has potential significance for understanding human disease processes:

  • Model for studying protein function conservation:

    • Identifying human orthologs or functional analogs of YPL238C

    • Understanding conserved pathways affected by YPL238C

    • Using yeast as a simplified system to dissect complex human disease mechanisms

    • Leveraging the extensive genetic tools available in yeast

  • Insights into fundamental cellular processes relevant to disease:

    • Genome stability pathways, which when dysregulated lead to cancer

    • Stress response mechanisms implicated in multiple diseases

    • Cellular aging processes that underlie age-related diseases

    • Protein quality control systems relevant to neurodegenerative disorders

  • Platform for therapeutic discovery:

    • Using YPL238C mutants to screen for compounds that affect relevant pathways

    • Identifying potential drug targets in conserved pathways

    • Testing mechanisms of action for existing drugs

    • Developing yeast-based biosensors for disease-relevant processes

  • Neurodegenerative disease connections:

    • Investigating potential roles in protein aggregation processes

    • Exploring connections to mitochondrial dysfunction, a common feature in neurodegeneration

    • Studying stress response pathways relevant to neuroprotection

    • Applying findings to yeast models of human neurodegenerative diseases

  • Aging and longevity research:

    • Understanding mechanisms that regulate lifespan, similar to studies of YBR238C

    • Exploring connections to conserved longevity pathways like TOR signaling

    • Investigating cellular resilience mechanisms that decline with age

    • Identifying potential interventions to promote healthy aging

S. cerevisiae has proven to be a valuable model for studying human neurodegenerative diseases and other disorders , and uncharacterized proteins like YPL238C may provide unexpected insights into disease mechanisms when their functions are fully elucidated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.