Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR126C (YPR126C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
YPR126C; P9642.2B; Putative uncharacterized protein YPR126C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPR126C
Target Protein Sequence
MLARVAESVSCGLMGQVKTGLLLFDGSGFSDRLGVMRFYVWSSRIYVLVLVVQAQLILDA HNGVLFLLLFFLHNFFLLPQLFQFLLSGCLIFLNDVYFNLMV
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YPR126C and how is it classified within S. cerevisiae proteome?

YPR126C represents a putative uncharacterized protein in the Saccharomyces cerevisiae genome. Like other uncharacterized proteins (such as YPR136C), it is identified by its chromosomal location - in this case, on chromosome XVI. The naming convention follows standard yeast nomenclature: "Y" designates yeast unknown sequence, "P" indicates chromosome XVI, "R" signifies the right arm of the chromosome, and "126" represents its position relative to the centromere, with "C" indicating it is encoded on the Crick strand . The protein is considered putative as its precise function remains to be fully characterized through experimental validation.

What approaches can be used for cloning and expressing YPR126C in recombinant systems?

For cloning and expressing YPR126C:

  • Gene Amplification: Use polymerase chain reaction (PCR) to amplify the YPR126C gene from S. cerevisiae genomic DNA with specifically designed primers containing appropriate restriction sites.

  • Vector Selection: Select an appropriate expression vector (like pGAPZαC, which has been successfully used for similar proteins) .

  • Cloning Procedure:

    • Digest both the PCR product and vector with restriction enzymes

    • Ligate the digested PCR product into the expression vector

    • Transform the recombinant plasmid into a competent host

  • Expression Verification: Confirm successful expression through:

    • Western blot analysis with anti-His tag antibodies (if a His-tag was incorporated)

    • PCR verification using primers specific to both the vector and insert

The choice of expression system should be guided by research objectives, with S. cerevisiae itself often preferred for maintaining native protein folding and post-translational modifications .

How can researchers verify successful transformation and expression of YPR126C?

Verification of successful transformation and expression requires multiple confirmatory approaches:

  • Diagnostic PCR:

    • Design primers that span the junction between the vector and insert

    • Run colony PCR on selected transformants

    • Verify correct insert size by agarose gel electrophoresis

  • Protein Expression Confirmation:

    • Use Western blot with antibodies directed against any epitope tags

    • For His-tagged constructs, anti-His antibodies provide specific detection

  • Functional Validation:

    • Compare growth curves of wild-type and transformed strains

    • Assess phenotypic changes in specialized media conditions

  • Quantitative Expression Analysis:

    • Implement real-time PCR to measure mRNA expression levels

    • Compare expression patterns under different growth conditions and timepoints

A comprehensive verification approach should include at least genomic integration confirmation via PCR and protein expression verification via Western blot .

What growth media and culture conditions are optimal for studying YPR126C function?

For optimal study of YPR126C function, consider these media formulations and culture conditions:

Standard Growth Media:

  • YPD (Yeast Peptone Dextrose): 1% yeast extract, 2% peptone, 2% glucose

  • SC (Synthetic Complete): 0.67% yeast nitrogen base, 2% glucose, appropriate amino acid supplements

Culture Conditions:

  • Temperature: 30°C is standard for S. cerevisiae growth

  • Agitation: 200-230 rpm for liquid cultures

  • Growth monitoring: Regular OD600 measurements to track growth phases

Specialized Conditions:

  • For stress response studies: Add relevant stressors (oxidative agents, temperature shifts)

  • For functional characterization: Compare growth in fermentable vs. non-fermentable carbon sources

Data Collection Parameters:

ParameterMeasurement FrequencyMethod
Growth rateEvery 2 hoursOD600 readings
Lag phaseOnce per experimentTime to reach OD600 of 0.1
Doubling timeCalculate from log phaseLinear regression of log-transformed OD data
YPR126C expressionKey timepointsqPCR or Western blot

The optimal approach includes parallel growth experiments comparing wild-type strains with YPR126C-modified strains under various conditions to identify functional differences .

What DNA extraction and quantification methods work best for YPR126C studies?

For reliable DNA extraction and quantification in YPR126C studies:

Genomic DNA Extraction Protocol:

  • Grow yeast cells to mid-log phase in appropriate medium

  • Harvest cells by centrifugation at 3000 rpm for 5 minutes

  • Resuspend cell pellet in 200 μL breaking buffer (2% Triton X-100, 1% SDS, 100 mM NaCl, 10 mM Tris-HCl pH 8.0, 1 mM EDTA)

  • Add 200 μL phenol:chloroform:isoamyl alcohol (25:24:1) and 0.3 g acid-washed glass beads

  • Vortex for 3-4 minutes to disrupt cell walls

  • Add 200 μL TE buffer and centrifuge at 13,000 rpm for 5 minutes

  • Transfer aqueous phase to fresh tube and precipitate DNA with 100% ethanol

  • Wash DNA pellet with 70% ethanol and resuspend in TE buffer with RNase A

DNA Quantification Methods:

  • Spectrophotometric measurement at 260 nm (A260/A280 ratio for purity assessment)

  • Fluorometric quantification using PicoGreen or similar dyes for higher sensitivity

  • Gel electrophoresis with known concentration standards for visual comparison

Quality Control Criteria:

  • A260/A280 ratio between 1.8-2.0 indicates high purity

  • Single band on agarose gel suggests minimal degradation

  • PCR amplification efficiency >95% confirms usability for downstream applications

This methodological approach ensures high-quality DNA for subsequent cloning, sequencing, and functional genomics studies of YPR126C .

How can quantitative trait locus (QTL) analysis be applied to understand YPR126C's contribution to phenotypic variation?

Quantitative trait locus analysis provides a powerful approach to identifying genetic variants of YPR126C that contribute to phenotypic differences between yeast strains:

QTL Analysis Protocol:

  • Population Generation: Create a mapping population by crossing strains with different YPR126C alleles and phenotypic responses

  • Phenotyping: Measure relevant quantitative traits in all segregants using standardized assays

  • Genotyping: Determine YPR126C genotype in each segregant through sequencing or marker analysis

  • Statistical Analysis: Apply appropriate statistical methods (interval mapping, composite interval mapping) to identify associations between YPR126C variants and phenotypic variation

Validation Approaches:

  • Reciprocal Hemizygosity Analysis (RHA): Create hemizygous strains containing only one allele of YPR126C and assess phenotypic differences

  • Allele Replacement: Replace YPR126C in one strain background with alleles from other strains

Data Analysis Framework:

Analysis StepTools/MethodsExpected Outcomes
QTL DetectionR/qtl, PLINKLOD scores, variance explained
Fine MappingNext-gen sequencingCandidate polymorphisms
Variant Effect PredictionSIFT, PolyPhenFunctional impact assessment
Experimental ValidationRHA, allele replacementConfirmation of causal variants

This comprehensive strategy allows researchers to attribute specific phenotypic effects to genetic variation within YPR126C and understand its contribution to complex traits .

What are the most effective gene deletion strategies for functional analysis of YPR126C?

For robust functional analysis of YPR126C through gene deletion:

PCR-Based Gene Deletion Protocol:

  • Primer Design: Create 40-45 bp primers with homology to regions flanking YPR126C and 20 bp homology to a selectable marker (kanMX)

  • PCR Amplification: Generate deletion cassette containing selectable marker flanked by YPR126C homology regions

  • Transformation: Transform deletion cassette into yeast using lithium acetate method

  • Selection: Plate transformants on appropriate selective media

  • Verification: Confirm deletion through diagnostic PCR using primers outside the target locus

Alternative Approaches:

  • CRISPR-Cas9: Design sgRNA targeting YPR126C and transform with Cas9 and repair template

  • Tetrad Dissection: For analysis in diploid strains, sporulate heterozygous deletion strains and dissect tetrads to analyze segregation patterns

Critical Considerations:

  • Nearby Essential Genes: Verify YPR126C deletion won't affect adjacent genes

  • Background Effects: Perform deletions in multiple strain backgrounds

  • Phenotypic Analysis: Comprehensive phenotyping under various growth conditions

  • Complementation Test: Re-introduce wild-type YPR126C to confirm phenotype rescue

Successful implementation requires careful primer design to ensure specific targeting and thorough verification to confirm complete deletion without affecting adjacent genomic regions .

How can researchers determine protein-protein interactions involving YPR126C?

To elucidate the protein interaction network of YPR126C:

Yeast Two-Hybrid (Y2H) Approach:

  • Clone YPR126C into bait vector (DNA-binding domain fusion)

  • Screen against prey library (activation domain fusions)

  • Select positive interactions based on reporter gene activation

  • Validate interactions through secondary screening methods

  • Characterize interaction domains through truncation constructs

Co-Immunoprecipitation Protocol:

  • Express epitope-tagged YPR126C in yeast cells

  • Prepare cell lysates under non-denaturing conditions

  • Capture YPR126C complexes using tag-specific antibodies

  • Identify interacting partners through mass spectrometry

  • Confirm specific interactions through reciprocal co-IP

Advanced Interaction Mapping Methods:

  • Proximity-Dependent Biotin Identification (BioID): Fuse YPR126C to biotin ligase

  • Fluorescence Resonance Energy Transfer (FRET): Tag YPR126C and candidate partners with fluorescent proteins

  • Protein Complementation Assays: Split reporter protein approach to detect interactions in vivo

Bioinformatic Analysis Pipeline:

  • Filter interaction data for statistical significance and reproducibility

  • Integrate with existing protein interaction databases

  • Perform Gene Ontology enrichment analysis of interaction partners

  • Construct interaction networks using visualization software

  • Generate testable hypotheses about YPR126C function based on interaction patterns

These comprehensive approaches provide both high-throughput screening capabilities and detailed interaction characterization necessary for understanding YPR126C's functional role in cellular processes .

What approaches can reveal the subcellular localization of YPR126C?

Determining the subcellular localization of YPR126C requires complementary experimental approaches:

Fluorescent Protein Fusion Methods:

  • C-terminal GFP Tagging:

    • Clone YPR126C with C-terminal GFP tag

    • Express in yeast under native or inducible promoter

    • Visualize using fluorescence microscopy

  • N-terminal GFP Tagging (if C-terminal tagging disrupts localization signals):

    • Design construct ensuring proper protein processing

    • Express and compare localization pattern with C-terminal fusion

Immunocytochemistry Approach:

  • Generate antibodies against YPR126C or epitope tag

  • Fix and permeabilize yeast cells

  • Incubate with primary antibodies against YPR126C

  • Detect with fluorophore-conjugated secondary antibodies

  • Co-stain with organelle markers (e.g., DAPI for nucleus, MitoTracker for mitochondria)

Biochemical Fractionation Protocol:

  • Prepare yeast spheroplasts by enzymatic cell wall digestion

  • Lyse cells using Dounce homogenizer

  • Separate cellular components by differential centrifugation

  • Analyze fractions by Western blotting with anti-YPR126C antibodies

  • Compare distribution with known organelle marker proteins

Quantitative Analysis:

Analysis ParameterMethodOutput
ColocalizationPearson's correlation coefficientDegree of overlap with organelle markers
Dynamic localizationTime-lapse microscopyTemporal changes in localization
Stimulus responseTreatment with various stressorsCondition-dependent localization shifts

These approaches provide complementary data to conclusively determine YPR126C's subcellular residence and potential relocation under different cellular conditions .

How can researchers analyze the effects of YPR126C overexpression on cellular physiology?

To comprehensively analyze the effects of YPR126C overexpression:

Expression System Design:

  • Clone YPR126C into vectors with different promoters:

    • Constitutive promoters (e.g., GPD, TEF1) for continuous expression

    • Inducible promoters (e.g., GAL1) for controlled expression

  • Include epitope tags for detection while confirming they don't affect function

  • Transform into appropriate yeast strains using lithium acetate method

Expression Verification:

  • Western blot analysis with tag-specific antibodies

  • qRT-PCR to quantify transcript levels

  • Compare expression levels across different constructs

Phenotypic Characterization Protocol:

  • Growth Analysis:

    • Compare growth curves in different media compositions

    • Measure doubling time and lag phase

    • Assess growth under various stress conditions

  • Metabolic Profiling:

    • Analyze glucose consumption and ethanol production rates

    • Measure oxygen consumption

    • Determine ATP/ADP ratios

  • Stress Response Assessment:

    • Challenge with oxidative stressors (H₂O₂, menadione)

    • Test temperature sensitivity

    • Evaluate response to osmotic stress

Advanced Analytical Approaches:

  • Transcriptome Analysis:

    • RNA-Seq comparing wild-type and YPR126C-overexpressing strains

    • Identify differentially expressed genes and affected pathways

  • Proteome Analysis:

    • Mass spectrometry-based quantitative proteomics

    • Identify proteins with altered abundance or modification state

ParameterWild-typeYPR126C OverexpressionStatistical Significance
Doubling timex hoursy hoursp-value
Stress tolerancebaseline% changep-value
Metabolite levelsbaseline% changep-value
Gene expression changes-# up/down regulatedFDR q-value

This systematic approach allows for comprehensive characterization of YPR126C's functional impact when overexpressed, providing insights into its normal physiological role .

Future Research Directions for YPR126C Characterization

The study of YPR126C in Saccharomyces cerevisiae represents an important area for advancing our understanding of yeast cellular biology. Based on methodological approaches outlined in this FAQ, several promising research directions emerge:

  • Integrative Functional Genomics: Combining deletion phenotyping, overexpression studies, and interactome analysis to develop a comprehensive functional model of YPR126C.

  • Comparative Genomics: Identifying potential homologs in other yeast species and higher eukaryotes to trace evolutionary conservation and functional divergence.

  • Structural Biology Approaches: Determining the three-dimensional structure of YPR126C to gain insights into potential molecular functions and interaction interfaces.

  • Systems Biology Integration: Incorporating YPR126C functional data into genome-scale metabolic models and regulatory networks to understand its broader cellular context.

  • Synthetic Biology Applications: Exploring potential biotechnological applications of YPR126C in metabolic engineering or stress resistance improvements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.