Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C) is a recombinant protein derived from the yeast Saccharomyces cerevisiae, specifically from the strain ATCC 204508 / S288c, commonly known as Baker's yeast. This protein is produced through recombinant DNA technology, where the gene encoding YPR130C is expressed in a suitable host system, often mammalian cells, to produce large quantities of the protein for research and potential applications .
Protein Sequence: The amino acid sequence of YPR130C starts with MYILNDILNLHRNIILKFNVGRRLRKLVGWSAVRVVLVLIGATIILVVISVLVVSTLAAS SSVSSVSPIISTPTTEASRVKSWSGRSLSKGVNVQHFFFLPSHIGISFSRSGDGVEKRRF FIIKLLIRFILLVNS .
Expression and Purification: YPR130C is typically expressed in mammalian cells and purified to a high degree (>85% purity by SDS-PAGE) .
Storage and Handling: The protein is stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .
While specific applications for YPR130C are not well-documented, recombinant proteins from Saccharomyces cerevisiae are widely used in biotechnology for producing enzymes, vaccines, and other therapeutic proteins . The ability to express heterologous proteins in S. cerevisiae makes it a valuable tool for industrial applications, including the production of recombinant proteins for research and medical use.
STRING: 4932.YPR130C
YPR130C is a putative uncharacterized protein found in Saccharomyces cerevisiae (Baker's yeast), specifically identified in strain ATCC 204508/S288c . This protein is cataloged in UniProt under accession number O13568 . Saccharomyces cerevisiae has been used for centuries in bread leavening and alcoholic beverage fermentation, making it one of the most well-studied eukaryotic model organisms . The "YPR130C" designation follows the systematic naming convention for S. cerevisiae open reading frames, where "Y" indicates a yeast origin, "PR" denotes its location on chromosome XVI, and "130" is its numerical identifier on that chromosome.
Several immunological techniques can be employed to detect YPR130C in experimental settings. Commercial antibodies are available for research applications, including polyclonal antibodies raised in rabbits that are suitable for ELISA and Western blot applications . These antibodies have been specifically tested for reactivity with S. cerevisiae strain ATCC 204508/S288c . When designing experiments, researchers should consider that these reagents are intended for research purposes only and not for diagnostic or therapeutic applications . For protein characterization, antibody-based detection methods should be complemented with molecular techniques such as RT-PCR for transcript analysis and mass spectrometry for proteomic validation.
When using antibodies for YPR130C detection, validation of specificity is crucial. Recommended approaches include:
Performing Western blots with both wild-type strains and YPR130C knockout mutants to confirm absence of signal in the knockout
Pre-adsorption tests using recombinant YPR130C protein
Comparing results from multiple antibodies targeting different epitopes of YPR130C
Including appropriate positive controls using recombinant YPR130C protein (strain ATCC 204508/S288c)
Validating antibody performance across different batches
Antibodies should be stored according to manufacturer recommendations (typically at -20°C or -80°C, avoiding repeated freeze-thaw cycles) to maintain reactivity . The buffer composition (50% Glycerol, 0.01M PBS, pH 7.4, with 0.03% Proclin 300 as preservative) helps maintain antibody stability during storage .
When designing experiments to study YPR130C expression, researchers should consider:
Replication strategy: Include a minimum of 3-5 biological replicates to account for natural variation in yeast expression patterns .
Sequencing parameters: For RNA-seq studies, consider whether paired-end or single-end sequencing is appropriate based on research questions .
Read depth: Determine appropriate sequencing depth based on expected expression levels of YPR130C .
Control selection: Include appropriate wild-type strains and consider using strains with known mutations in related pathways.
Growth conditions: Standardize growth conditions including media composition, temperature, and growth phase at harvest.
The experimental design should be tailored to the specific research question, with particular attention to controlling sources of technical variation that could impact data quality and interpretation .
RNA-seq experimental design for YPR130C studies should address several critical parameters:
Number of replicates: Include at least 3 biological replicates to ensure statistical power, though more replicates (4-6) are recommended for detecting subtle expression changes .
Sequencing strategy: Consider paired-end sequencing for improved transcript mapping and isoform detection, particularly if alternative splicing is of interest .
Read length: Longer reads (≥75bp) improve mapping accuracy, especially in regions with sequence similarity to other yeast genes .
Sequencing depth: Aim for at least 20 million reads per sample for adequate coverage of the transcriptome, including low-abundance transcripts .
Quality control: Include steps to assess RNA quality (RIN score >7 recommended) and library preparation quality .
Technical variation in RNA-seq experiments stems from many sources, including RNA quality and quantity differences, library preparation batch effects, flow cell variations, and adapter bias . These factors should be carefully controlled and documented.
When investigating YPR130C function, researchers should consider various growth conditions that might influence its expression or activity:
Carbon source variation: Compare growth in glucose, galactose, glycerol, and ethanol to identify potential metabolic roles.
Nitrogen limitation: Evaluate effects of nitrogen restriction on YPR130C expression.
Growth phase: Sample during log phase, diauxic shift, and stationary phase to capture temporal expression patterns.
Stress conditions: Test responses to oxidative stress, heat shock, osmotic stress, and nutrient limitation.
Oxygen availability: Compare aerobic versus anaerobic conditions if respiratory functions are suspected.
S. cerevisiae is highly adaptable to various environmental conditions, making it important to standardize and thoroughly document cultivation parameters . Since S. cerevisiae is ubiquitous in nature, careful attention to contamination control is essential for experimental reproducibility.
A comprehensive RNA-seq analysis pipeline for YPR130C studies should include:
Quality control: Use tools like FastQC to assess read quality, followed by trimming of low-quality bases and adapter sequences .
Read alignment: Align reads to the S. cerevisiae reference genome (S288c recommended) using STAR or HISAT2 aligners .
Read assignment: Assign aligned reads to genes/transcripts using featureCounts or HTSeq .
Abundance estimation: Calculate expression levels as TPM, FPKM, or raw counts .
Differential expression analysis: Use DESeq2 or edgeR to identify significant changes in YPR130C expression between conditions .
Functional analysis: Perform GO term enrichment and pathway analysis to contextualize YPR130C function.
This pipeline should be consistently applied across all samples to ensure comparability, with special attention to batch effects and other sources of technical variation .
When analyzing experimental variables in YPR130C studies, researchers should:
Clearly define independent and dependent variables: The independent variables are those manipulated by the researcher (e.g., growth conditions, genetic modifications), while dependent variables are the measured outcomes (e.g., YPR130C expression levels, phenotypic changes) .
Create appropriate visualization: Plot independent variables on the x-axis and dependent variables on the y-axis for clarity in data presentation .
Apply statistical analysis: Use appropriate statistical tests based on experimental design, sample size, and data distribution.
Compare and contrast experimental conditions: Systematically analyze how changes in experimental conditions affect YPR130C expression or function .
Consider hypothetical modifications: Evaluate how changes to experimental parameters might affect outcomes, which can guide future experimental design .
When comparing multiple experiments, identify similarities and differences in methodology to properly contextualize results . This approach allows for robust interpretation of YPR130C data across different experimental conditions.
The statistical approach for YPR130C expression analysis should be tailored to the experimental design:
To characterize the molecular function of the putative uncharacterized protein YPR130C, researchers can employ several complementary approaches:
Protein interaction studies:
Localization studies:
Functional genomics:
Phenotypic analysis of YPR130C deletion mutants under various conditions
Systematic genetic interaction mapping using synthetic genetic array analysis
Transcriptome analysis of YPR130C mutants vs. wild-type strains using RNA-seq
These multifaceted approaches can provide insights into the biological role of YPR130C in cellular processes and potentially reveal its molecular function.
CRISPR-Cas9 technology offers powerful approaches for studying YPR130C:
Gene knockout:
Design sgRNAs targeting the YPR130C coding sequence
Create precise deletions with or without marker integration
Validate gene disruption via sequencing and expression analysis
Tagging strategies:
Insert epitope tags or fluorescent proteins at the C- or N-terminus
Create fusion proteins while maintaining native expression control
Use homology-directed repair to ensure precise integration
Base editing applications:
Introduce point mutations to study specific amino acid residues
Create regulatory element modifications to study expression control
Engineer conditional alleles for temporal functional studies
CRISPRi/CRISPRa implementations:
Employ catalytically dead Cas9 (dCas9) fused to repressors to downregulate YPR130C
Use dCas9-activator fusions to upregulate YPR130C expression
Apply inducible systems for temporal control of expression modulation
When implementing CRISPR-Cas9 approaches, careful sgRNA design is essential to minimize off-target effects, and comprehensive validation of genetic modifications should be performed.
Comparative genomics can provide valuable insights into YPR130C function through evolutionary analysis:
Ortholog identification:
Search for YPR130C homologs across yeast species and other fungi
Analyze presence/absence patterns across evolutionary lineages
Identify conserved domains that might indicate functional roles
Sequence conservation analysis:
Perform multiple sequence alignments of YPR130C orthologs
Calculate evolutionary conservation scores for specific residues
Identify regions under purifying or positive selection
Synteny analysis:
Examine conservation of genomic context around YPR130C
Identify co-evolved gene clusters that might suggest functional relationships
Analyze chromosomal rearrangements affecting YPR130C positioning
Structural prediction comparisons:
Generate structural models of YPR130C and orthologs
Compare predicted structures to identify conserved structural elements
Identify potential functional sites based on structural conservation
S. cerevisiae has been extensively used as a model organism, with considerable genomic data available for comparative analysis . The evolutionary conservation pattern of YPR130C can provide crucial clues about its functional importance and potential role in yeast biology.
Researchers may encounter several challenges when attempting to detect YPR130C expression:
Low expression levels:
Antibody specificity issues:
Technical variability:
Standardize RNA extraction methods across all samples
Process samples in random order to avoid batch effects
Include technical replicates to assess method reproducibility
Carefully document all experimental parameters for troubleshooting
When troubleshooting expression detection issues, systematic evaluation of each step in the workflow is essential, from sample preparation through data analysis.
When conducting functional studies of YPR130C, contextualizing within broader S. cerevisiae biology is essential:
Consider cellular environment:
Account for genetic background effects:
Use isogenic strains for all comparisons
Consider potential interactions with strain-specific genetic elements
Validate key findings in multiple strain backgrounds
Examine physiological relevance:
Connect molecular observations to physiological outcomes
Consider YPR130C in the context of yeast metabolism and life cycle
Evaluate whether YPR130C might function in known yeast processes
Address potential redundancy:
Identify potential paralogs that might mask phenotypes
Consider creating double/triple mutants to overcome functional redundancy
Examine condition-specific roles that might not be apparent under standard conditions
S. cerevisiae has been extensively studied as a model organism, providing a rich context for interpreting YPR130C function . This background knowledge should be leveraged to guide experimental design and hypothesis generation.
While S. cerevisiae is generally regarded as safe, researchers should implement appropriate safety measures:
Biosafety level considerations:
S. cerevisiae is typically handled at Biosafety Level 1 (BSL-1)
Recombinant strains may require BSL-2 depending on modifications
Follow institutional biosafety committee guidelines for recombinant work
Exposure prevention:
Risk assessment:
Waste management:
Decontaminate all materials that contact cultures
Follow institutional guidelines for disposal of recombinant materials
Document all safety procedures according to regulatory requirements
While S. cerevisiae has a long history of safe use, proper laboratory practices should always be maintained, particularly when working with recombinant strains .
Several advanced approaches show promise for uncovering YPR130C function:
Integrative multi-omics:
Combine transcriptomics, proteomics, and metabolomics data
Correlate YPR130C expression with global cellular changes
Apply network analysis to position YPR130C in cellular pathways
Single-cell approaches:
Employ single-cell RNA-seq to examine cell-to-cell variability in YPR130C expression
Use time-lapse microscopy with tagged YPR130C to track dynamics
Apply microfluidics-based approaches for controlled perturbation studies
Systematic genetic interaction mapping:
Perform genome-wide synthetic genetic array analysis with YPR130C mutants
Use CRISPR screens to identify genetic dependencies
Apply chemogenomic profiling to identify condition-specific interactions
Structural biology integration:
Determine YPR130C structure using X-ray crystallography or cryo-EM
Perform structure-guided mutagenesis to test functional hypotheses
Use computational approaches to predict ligand binding sites
These integrative approaches can provide complementary insights that may reveal unexpected functions of YPR130C and position it within the broader context of yeast cell biology.
Emerging technologies offer new opportunities for YPR130C research:
Advanced sequencing approaches:
Long-read sequencing for improved transcript isoform detection
Direct RNA sequencing to identify post-transcriptional modifications
Spatial transcriptomics to examine localized expression patterns
Protein analysis innovations:
Targeted proteomics using parallel reaction monitoring for sensitive detection
Thermal proteome profiling to identify ligand interactions
Hydrogen-deuterium exchange mass spectrometry for structural dynamics
Live-cell imaging advancements:
Super-resolution microscopy for detailed localization studies
Optogenetic approaches for temporal control of YPR130C activity
FRET-based biosensors to monitor YPR130C interactions in real-time
Computational prediction improvements:
Integration of deep learning approaches for function prediction
Molecular dynamics simulations to explore conformational dynamics
Advanced homology modeling incorporating co-evolutionary information These methodological advances can help overcome current limitations in studying putative uncharacterized proteins like YPR130C, potentially revealing functions that have remained elusive with conventional approaches.