Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YPR130C (YPR130C)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C) is a recombinant protein derived from the yeast Saccharomyces cerevisiae, specifically from the strain ATCC 204508 / S288c, commonly known as Baker's yeast. This protein is produced through recombinant DNA technology, where the gene encoding YPR130C is expressed in a suitable host system, often mammalian cells, to produce large quantities of the protein for research and potential applications .

Characteristics of YPR130C

  • Protein Sequence: The amino acid sequence of YPR130C starts with MYILNDILNLHRNIILKFNVGRRLRKLVGWSAVRVVLVLIGATIILVVISVLVVSTLAAS SSVSSVSPIISTPTTEASRVKSWSGRSLSKGVNVQHFFFLPSHIGISFSRSGDGVEKRRF FIIKLLIRFILLVNS .

  • Expression and Purification: YPR130C is typically expressed in mammalian cells and purified to a high degree (>85% purity by SDS-PAGE) .

  • Storage and Handling: The protein is stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

Potential Applications

While specific applications for YPR130C are not well-documented, recombinant proteins from Saccharomyces cerevisiae are widely used in biotechnology for producing enzymes, vaccines, and other therapeutic proteins . The ability to express heterologous proteins in S. cerevisiae makes it a valuable tool for industrial applications, including the production of recombinant proteins for research and medical use.

References ELISA Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C). A comparative study of the cryo-EM structures of Saccharomyces cerevisiae APC/C. Up-to-date catalogues of yeast protein complexes. Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C), partial. Saccharomyces cerevisiae and its industrial applications. Comprehensive Analysis of Signal Peptides in Saccharomyces cerevisiae Reveals Features for Efficient Secretion. Oral Immunization with Recombinant Saccharomyces cerevisiae expressing the capsid protein VP2 of IBDV.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its inclusion.
Synonyms
YPR130C; P9659.10A; Putative uncharacterized protein YPR130C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPR130C
Target Protein Sequence
MYILNDILNLHRNIILKFNVGRRLRKLVGWSAVRVVLVLIGATIILVVISVLVVSTLAAS SSVSSVSPIISTPTTEASRVKSWSGRSLSKGVNVQHFFFLPSHIGISFSRSGDGVEKRRF FIIKLLIRFILLVNS
Uniprot No.

Target Background

Database Links

STRING: 4932.YPR130C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YPR130C and what organism does it originate from?

YPR130C is a putative uncharacterized protein found in Saccharomyces cerevisiae (Baker's yeast), specifically identified in strain ATCC 204508/S288c . This protein is cataloged in UniProt under accession number O13568 . Saccharomyces cerevisiae has been used for centuries in bread leavening and alcoholic beverage fermentation, making it one of the most well-studied eukaryotic model organisms . The "YPR130C" designation follows the systematic naming convention for S. cerevisiae open reading frames, where "Y" indicates a yeast origin, "PR" denotes its location on chromosome XVI, and "130" is its numerical identifier on that chromosome.

What detection methods are available for studying YPR130C?

Several immunological techniques can be employed to detect YPR130C in experimental settings. Commercial antibodies are available for research applications, including polyclonal antibodies raised in rabbits that are suitable for ELISA and Western blot applications . These antibodies have been specifically tested for reactivity with S. cerevisiae strain ATCC 204508/S288c . When designing experiments, researchers should consider that these reagents are intended for research purposes only and not for diagnostic or therapeutic applications . For protein characterization, antibody-based detection methods should be complemented with molecular techniques such as RT-PCR for transcript analysis and mass spectrometry for proteomic validation.

What is the recommended approach for confirming antibody specificity for YPR130C studies?

When using antibodies for YPR130C detection, validation of specificity is crucial. Recommended approaches include:

  • Performing Western blots with both wild-type strains and YPR130C knockout mutants to confirm absence of signal in the knockout

  • Pre-adsorption tests using recombinant YPR130C protein

  • Comparing results from multiple antibodies targeting different epitopes of YPR130C

  • Including appropriate positive controls using recombinant YPR130C protein (strain ATCC 204508/S288c)

  • Validating antibody performance across different batches
    Antibodies should be stored according to manufacturer recommendations (typically at -20°C or -80°C, avoiding repeated freeze-thaw cycles) to maintain reactivity . The buffer composition (50% Glycerol, 0.01M PBS, pH 7.4, with 0.03% Proclin 300 as preservative) helps maintain antibody stability during storage .

What are key considerations for experimental design when studying YPR130C expression?

When designing experiments to study YPR130C expression, researchers should consider:

  • Replication strategy: Include a minimum of 3-5 biological replicates to account for natural variation in yeast expression patterns .

  • Sequencing parameters: For RNA-seq studies, consider whether paired-end or single-end sequencing is appropriate based on research questions .

  • Read depth: Determine appropriate sequencing depth based on expected expression levels of YPR130C .

  • Control selection: Include appropriate wild-type strains and consider using strains with known mutations in related pathways.

  • Growth conditions: Standardize growth conditions including media composition, temperature, and growth phase at harvest.
    The experimental design should be tailored to the specific research question, with particular attention to controlling sources of technical variation that could impact data quality and interpretation .

How should researchers approach RNA-seq experimental design for YPR130C studies?

RNA-seq experimental design for YPR130C studies should address several critical parameters:

  • Number of replicates: Include at least 3 biological replicates to ensure statistical power, though more replicates (4-6) are recommended for detecting subtle expression changes .

  • Sequencing strategy: Consider paired-end sequencing for improved transcript mapping and isoform detection, particularly if alternative splicing is of interest .

  • Read length: Longer reads (≥75bp) improve mapping accuracy, especially in regions with sequence similarity to other yeast genes .

  • Sequencing depth: Aim for at least 20 million reads per sample for adequate coverage of the transcriptome, including low-abundance transcripts .

  • Quality control: Include steps to assess RNA quality (RIN score >7 recommended) and library preparation quality .
    Technical variation in RNA-seq experiments stems from many sources, including RNA quality and quantity differences, library preparation batch effects, flow cell variations, and adapter bias . These factors should be carefully controlled and documented.

What growth conditions should be considered when studying YPR130C function?

When investigating YPR130C function, researchers should consider various growth conditions that might influence its expression or activity:

  • Carbon source variation: Compare growth in glucose, galactose, glycerol, and ethanol to identify potential metabolic roles.

  • Nitrogen limitation: Evaluate effects of nitrogen restriction on YPR130C expression.

  • Growth phase: Sample during log phase, diauxic shift, and stationary phase to capture temporal expression patterns.

  • Stress conditions: Test responses to oxidative stress, heat shock, osmotic stress, and nutrient limitation.

  • Oxygen availability: Compare aerobic versus anaerobic conditions if respiratory functions are suspected.
    S. cerevisiae is highly adaptable to various environmental conditions, making it important to standardize and thoroughly document cultivation parameters . Since S. cerevisiae is ubiquitous in nature, careful attention to contamination control is essential for experimental reproducibility.

What is a recommended RNA-seq analysis pipeline for YPR130C expression studies?

A comprehensive RNA-seq analysis pipeline for YPR130C studies should include:

  • Quality control: Use tools like FastQC to assess read quality, followed by trimming of low-quality bases and adapter sequences .

  • Read alignment: Align reads to the S. cerevisiae reference genome (S288c recommended) using STAR or HISAT2 aligners .

  • Read assignment: Assign aligned reads to genes/transcripts using featureCounts or HTSeq .

  • Abundance estimation: Calculate expression levels as TPM, FPKM, or raw counts .

  • Differential expression analysis: Use DESeq2 or edgeR to identify significant changes in YPR130C expression between conditions .

  • Functional analysis: Perform GO term enrichment and pathway analysis to contextualize YPR130C function.
    This pipeline should be consistently applied across all samples to ensure comparability, with special attention to batch effects and other sources of technical variation .

How can researchers effectively analyze experimental variables when studying YPR130C?

When analyzing experimental variables in YPR130C studies, researchers should:

  • Clearly define independent and dependent variables: The independent variables are those manipulated by the researcher (e.g., growth conditions, genetic modifications), while dependent variables are the measured outcomes (e.g., YPR130C expression levels, phenotypic changes) .

  • Create appropriate visualization: Plot independent variables on the x-axis and dependent variables on the y-axis for clarity in data presentation .

  • Apply statistical analysis: Use appropriate statistical tests based on experimental design, sample size, and data distribution.

  • Compare and contrast experimental conditions: Systematically analyze how changes in experimental conditions affect YPR130C expression or function .

  • Consider hypothetical modifications: Evaluate how changes to experimental parameters might affect outcomes, which can guide future experimental design .
    When comparing multiple experiments, identify similarities and differences in methodology to properly contextualize results . This approach allows for robust interpretation of YPR130C data across different experimental conditions.

What statistical approaches are most appropriate for analyzing YPR130C expression data?

The statistical approach for YPR130C expression analysis should be tailored to the experimental design:

What approaches can be used to characterize the molecular function of YPR130C?

To characterize the molecular function of the putative uncharacterized protein YPR130C, researchers can employ several complementary approaches:

  • Protein interaction studies:

    • Yeast two-hybrid screening to identify protein binding partners

    • Co-immunoprecipitation using anti-YPR130C antibodies followed by mass spectrometry

    • Proximity labeling approaches (BioID or APEX) to identify proximal proteins in vivo

  • Localization studies:

    • Fluorescent protein tagging of YPR130C to determine subcellular localization

    • Immunofluorescence using validated YPR130C antibodies

    • Subcellular fractionation followed by Western blot analysis

  • Functional genomics:

    • Phenotypic analysis of YPR130C deletion mutants under various conditions

    • Systematic genetic interaction mapping using synthetic genetic array analysis

    • Transcriptome analysis of YPR130C mutants vs. wild-type strains using RNA-seq
      These multifaceted approaches can provide insights into the biological role of YPR130C in cellular processes and potentially reveal its molecular function.

How can CRISPR-Cas9 be utilized for studying YPR130C function in S. cerevisiae?

CRISPR-Cas9 technology offers powerful approaches for studying YPR130C:

  • Gene knockout:

    • Design sgRNAs targeting the YPR130C coding sequence

    • Create precise deletions with or without marker integration

    • Validate gene disruption via sequencing and expression analysis

  • Tagging strategies:

    • Insert epitope tags or fluorescent proteins at the C- or N-terminus

    • Create fusion proteins while maintaining native expression control

    • Use homology-directed repair to ensure precise integration

  • Base editing applications:

    • Introduce point mutations to study specific amino acid residues

    • Create regulatory element modifications to study expression control

    • Engineer conditional alleles for temporal functional studies

  • CRISPRi/CRISPRa implementations:

    • Employ catalytically dead Cas9 (dCas9) fused to repressors to downregulate YPR130C

    • Use dCas9-activator fusions to upregulate YPR130C expression

    • Apply inducible systems for temporal control of expression modulation
      When implementing CRISPR-Cas9 approaches, careful sgRNA design is essential to minimize off-target effects, and comprehensive validation of genetic modifications should be performed.

What comparative genomics approaches can reveal insights about YPR130C conservation and evolution?

Comparative genomics can provide valuable insights into YPR130C function through evolutionary analysis:

  • Ortholog identification:

    • Search for YPR130C homologs across yeast species and other fungi

    • Analyze presence/absence patterns across evolutionary lineages

    • Identify conserved domains that might indicate functional roles

  • Sequence conservation analysis:

    • Perform multiple sequence alignments of YPR130C orthologs

    • Calculate evolutionary conservation scores for specific residues

    • Identify regions under purifying or positive selection

  • Synteny analysis:

    • Examine conservation of genomic context around YPR130C

    • Identify co-evolved gene clusters that might suggest functional relationships

    • Analyze chromosomal rearrangements affecting YPR130C positioning

  • Structural prediction comparisons:

    • Generate structural models of YPR130C and orthologs

    • Compare predicted structures to identify conserved structural elements

    • Identify potential functional sites based on structural conservation
      S. cerevisiae has been extensively used as a model organism, with considerable genomic data available for comparative analysis . The evolutionary conservation pattern of YPR130C can provide crucial clues about its functional importance and potential role in yeast biology.

What are common challenges in detecting YPR130C expression and how can they be overcome?

Researchers may encounter several challenges when attempting to detect YPR130C expression:

  • Low expression levels:

    • Increase RNA-seq depth to at least 30-40 million reads per sample

    • Use more sensitive detection methods like digital droplet PCR

    • Consider enrichment strategies before analysis

    • Implement rRNA depletion to increase coverage of mRNA transcripts

  • Antibody specificity issues:

    • Validate antibody specificity using YPR130C knockout strains

    • Test multiple antibodies targeting different epitopes

    • Optimize antibody concentration and incubation conditions

    • Include appropriate positive and negative controls in all experiments

  • Technical variability:

    • Standardize RNA extraction methods across all samples

    • Process samples in random order to avoid batch effects

    • Include technical replicates to assess method reproducibility

    • Carefully document all experimental parameters for troubleshooting
      When troubleshooting expression detection issues, systematic evaluation of each step in the workflow is essential, from sample preparation through data analysis.

How should researchers approach YPR130C functional studies in the context of S. cerevisiae biology?

When conducting functional studies of YPR130C, contextualizing within broader S. cerevisiae biology is essential:

  • Consider cellular environment:

    • S. cerevisiae is ubiquitous in nature and highly adaptable

    • YPR130C function may be condition-dependent or stress-responsive

    • Evaluate phenotypes under multiple environmental conditions

  • Account for genetic background effects:

    • Use isogenic strains for all comparisons

    • Consider potential interactions with strain-specific genetic elements

    • Validate key findings in multiple strain backgrounds

  • Examine physiological relevance:

    • Connect molecular observations to physiological outcomes

    • Consider YPR130C in the context of yeast metabolism and life cycle

    • Evaluate whether YPR130C might function in known yeast processes

  • Address potential redundancy:

    • Identify potential paralogs that might mask phenotypes

    • Consider creating double/triple mutants to overcome functional redundancy

    • Examine condition-specific roles that might not be apparent under standard conditions
      S. cerevisiae has been extensively studied as a model organism, providing a rich context for interpreting YPR130C function . This background knowledge should be leveraged to guide experimental design and hypothesis generation.

What safety considerations should researchers address when working with recombinant S. cerevisiae expressing YPR130C?

While S. cerevisiae is generally regarded as safe, researchers should implement appropriate safety measures:

  • Biosafety level considerations:

    • S. cerevisiae is typically handled at Biosafety Level 1 (BSL-1)

    • Recombinant strains may require BSL-2 depending on modifications

    • Follow institutional biosafety committee guidelines for recombinant work

  • Exposure prevention:

    • S. cerevisiae is ubiquitous in nature and humans come into contact through inhalation and ingestion

    • Laboratory workers should use appropriate personal protective equipment

    • Implement proper containment measures to prevent environmental release

  • Risk assessment:

    • S. cerevisiae is not typically associated with disease conditions in plants or animals

    • Some strains produce "killer toxins" with limited target range to susceptible yeasts

    • In rare cases, S. cerevisiae can act as an opportunistic pathogen in immunocompromised individuals

  • Waste management:

    • Decontaminate all materials that contact cultures

    • Follow institutional guidelines for disposal of recombinant materials

    • Document all safety procedures according to regulatory requirements
      While S. cerevisiae has a long history of safe use, proper laboratory practices should always be maintained, particularly when working with recombinant strains .

What are promising approaches for elucidating the role of YPR130C in cellular pathways?

Several advanced approaches show promise for uncovering YPR130C function:

  • Integrative multi-omics:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate YPR130C expression with global cellular changes

    • Apply network analysis to position YPR130C in cellular pathways

  • Single-cell approaches:

    • Employ single-cell RNA-seq to examine cell-to-cell variability in YPR130C expression

    • Use time-lapse microscopy with tagged YPR130C to track dynamics

    • Apply microfluidics-based approaches for controlled perturbation studies

  • Systematic genetic interaction mapping:

    • Perform genome-wide synthetic genetic array analysis with YPR130C mutants

    • Use CRISPR screens to identify genetic dependencies

    • Apply chemogenomic profiling to identify condition-specific interactions

  • Structural biology integration:

    • Determine YPR130C structure using X-ray crystallography or cryo-EM

    • Perform structure-guided mutagenesis to test functional hypotheses

    • Use computational approaches to predict ligand binding sites
      These integrative approaches can provide complementary insights that may reveal unexpected functions of YPR130C and position it within the broader context of yeast cell biology.

How can novel techniques improve detection and characterization of YPR130C?

Emerging technologies offer new opportunities for YPR130C research:

  • Advanced sequencing approaches:

    • Long-read sequencing for improved transcript isoform detection

    • Direct RNA sequencing to identify post-transcriptional modifications

    • Spatial transcriptomics to examine localized expression patterns

  • Protein analysis innovations:

    • Targeted proteomics using parallel reaction monitoring for sensitive detection

    • Thermal proteome profiling to identify ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry for structural dynamics

  • Live-cell imaging advancements:

    • Super-resolution microscopy for detailed localization studies

    • Optogenetic approaches for temporal control of YPR130C activity

    • FRET-based biosensors to monitor YPR130C interactions in real-time

  • Computational prediction improvements:

    • Integration of deep learning approaches for function prediction

    • Molecular dynamics simulations to explore conformational dynamics

    • Advanced homology modeling incorporating co-evolutionary information These methodological advances can help overcome current limitations in studying putative uncharacterized proteins like YPR130C, potentially revealing functions that have remained elusive with conventional approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.