Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR142C (YPR142C)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein YPR142C (YPR142C) is a protein of interest in yeast molecular biology, produced through heterologous expression in E. coli. Despite being annotated as a "dubious" open reading frame (ORF) in genomic databases , it has been commercially synthesized for research purposes. This article synthesizes structural, functional, and experimental data from diverse sources to evaluate its biological and biotechnological relevance.

Functional Annotations and Genomic Context

YPR142C is annotated inconsistently across databases:

  • Saccharomyces Genome Database (SGD): Labeled as a "dubious ORF" unlikely to encode a functional protein due to lack of experimental evidence .

  • SCMD2 Database: Overlaps with RRP15 (YPR143W), an essential gene required for ribosomal RNA processing .

Gene Interactions:

GeneViabilityOverlapping GeneBiological Process
YPR142CEssentialRRP15 (YPR143W)rRNA processing (via RRP15)
Data derived from HIP assay studies

Research Findings on Biological Role

Despite its dubious classification, YPR142C appears in studies investigating RNA-processing pathways:

  • Essentiality: HIP assays classified YPR142C as "essential," though this phenotype likely stems from its overlap with RRP15 .

  • Protein Interactions: Co-purifies with ribosomal subunits, suggesting indirect involvement in rRNA maturation .

Key Discrepancies:

  • Computational analyses suggest non-functionality .

  • Experimental data imply indirect roles via genomic proximity to critical genes .

Recombinant Protein Applications

Commercial vendors (e.g., Creative BioMart, AmericanSci) produce recombinant YPR142C for:

  • Antibody development

  • Structural studies

  • In vitro binding assays

Product Variants:

VendorCatalog No.TagFormat
AmericanSciCSB-CF515558SVGVariableLyophilized
Creative BioMartRFL28302SFHis-tagLyophilized

Knowledge Gaps and Future Directions

  1. Functional Validation: No direct evidence exists for YPR142C’s standalone biochemical activity.

  2. Overlap Resolution: Genetic studies using CRISPR/cas9 to decouple YPR142C from RRP15 could clarify its role.

  3. Evolutionary Conservation: Absence in closely related yeast species supports non-functional status .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your needs.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPR142C; P9659.16B; Putative uncharacterized protein YPR142C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPR142C
Target Protein Sequence
MMGSFLSYAFRCDDKIAFTAAENPVEPSSCLLFFDFFFLGKSSSSSSSSSSSSASLCSLS IILDDSSLELFCSSSSASSPSIIVSFSGSLLNSWLPLFLFSRPNSAFFLVLFLSLVSTLC LEPMINYVLIFLRLLYRFIHSICLLPFLISYGHRILDFFLSKFSNKRVMEIHQNESQTKS KQTLFTI
Uniprot No.

Target Background

Database Links

STRING: 4932.YPR142C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the current annotation status of YPR142C in Saccharomyces cerevisiae?

YPR142C represents one of many open reading frames in the S. cerevisiae genome classified as "uncharacterized" or "hypothetical." Similar to uncharacterized proteins described in other organisms, it likely remains functionally undefined due to insufficient sequence homology with characterized proteins or lack of structurally related proteins in databases . The designation indicates that while the sequence has been identified during genome sequencing, its biological role, biochemical functions, and structural properties remain largely unknown.

Functional annotation of such proteins requires comprehensive bioinformatic analysis using multiple prediction tools and experimental validation. As observed with similar annotation efforts, proteins initially designated as uncharacterized may be revealed to serve critical cellular functions, potentially including enzymatic activity, structural roles, or regulatory functions .

What computational approaches should researchers employ to predict potential functions of YPR142C?

A systematic, multi-tool approach is essential for predicting functions of uncharacterized proteins like YPR142C:

  • Physicochemical property prediction: Utilize programs like Expasy's ProtParam to determine molecular weight, extinction coefficient, isoelectric point, GRAVY (grand average of hydropathicity), and instability index. These parameters provide initial insights into protein stability and solubility .

  • Domain identification: Apply multiple prediction tools including InterProScan, Motif, SMART, HMMER, NCBI CDART, and BlastP searches. Functions should only be assigned when conserved domains are predicted by two or more databases to increase confidence .

  • Subcellular localization prediction: Use localization prediction servers to determine probable cellular compartmentalization.

  • Interaction network analysis: Employ string analysis to identify potential interacting partners that may suggest functional associations .

  • Structural modeling: Apply homology-based structure prediction and modeling using Swiss PDB and Phyre2 servers to gain insights into potential functional regions .

This multi-faceted approach has demonstrated approximately 83.6% accuracy according to receiver operating characteristics analysis for similar uncharacterized protein annotation projects .

How should researchers design experiments to determine the biological role of YPR142C?

Effective experimental design for characterizing YPR142C requires careful consideration of independent, dependent, and control variables to ensure valid, reliable, and replicable results :

  • Knockout/overexpression studies: Design parallel experiments examining:

    • YPR142C gene deletion strain phenotypes

    • YPR142C overexpression strain phenotypes

    • Control strain with wild-type expression levels

  • Environmental variable testing: Subject experimental and control strains to various stressors (temperature, pH, nutrient limitation, oxidative stress) to reveal condition-specific functions.

  • Statistical optimization: Design the experiment to achieve appropriate statistical power and sensitivity using principles of DOE (Design of Experiments) .

  • Validation through complementary approaches: Plan for both in vivo phenotypic assessments and in vitro biochemical characterization to corroborate findings.

  • Documentation: Ensure detailed documentation of methods to support replicability by other researchers .

Your experimental design should establish clear causal relationships between YPR142C and observed phenotypes while controlling for external factors that could confound results .

What recombinant expression systems are most suitable for characterizing YPR142C?

Based on experimental approaches with other S. cerevisiae proteins, the following expression systems should be considered:

  • Homologous expression in S. cerevisiae:

    • Vector selection: pGAPZαC or similar vectors that provide constitutive expression

    • Transformation method: Electroporation following linearization with appropriate restriction enzymes (e.g., AvrII)

    • Selection: Zeocin resistance markers (100 mg/L) for selecting transformed yeast

    • Advantages: Native post-translational modifications, appropriate folding environment

  • Heterologous expression in E. coli:

    • Vector options: pET series vectors with His-tag for purification

    • Verification: Western blot with anti-His tag antibodies to confirm expression

    • Considerations: May require optimization of codon usage and growth conditions

  • Cell-free expression systems:

    • Appropriate for proteins that may be toxic when expressed in vivo

    • Enables rapid screening of protein function

The optimal expression system should be selected based on the specific experimental objectives, required protein yield, and downstream applications.

How can researchers effectively isolate and purify recombinant YPR142C for structural studies?

Structural characterization of YPR142C requires highly purified protein samples. The following purification strategy is recommended:

  • Expression optimization:

    • Engineer constructs with appropriate affinity tags (His-tag, GST-tag)

    • Test multiple expression conditions (temperature, induction time, media composition)

    • Verify expression using Western blot analysis with tag-specific antibodies

  • Cell lysis and initial clarification:

    • For yeast expression: Use glass bead disruption or enzymatic cell wall digestion

    • For E. coli expression: Employ sonication or high-pressure homogenization

    • Remove cell debris by centrifugation (15,000×g, 30 min, 4°C)

  • Purification scheme:

    • Primary capture: Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Intermediate purification: Ion exchange chromatography based on predicted isoelectric point

    • Polishing: Size exclusion chromatography to achieve >95% purity

    • Buffer optimization: Screen buffers for maximum stability using differential scanning fluorimetry

  • Quality control assessments:

    • SDS-PAGE and Western blot to confirm identity and purity

    • Dynamic light scattering to assess homogeneity

    • Mass spectrometry to confirm molecular weight and sequence

This systematic approach maximizes the likelihood of obtaining structurally and functionally intact YPR142C protein suitable for crystallography, NMR, or cryo-EM studies.

What approaches should be used to identify potential interaction partners of YPR142C?

Understanding protein-protein interactions is crucial for functional characterization of uncharacterized proteins like YPR142C:

  • In silico prediction:

    • String analysis to predict potential interaction networks based on genomic context, co-expression, and text mining

    • Domain-based interaction prediction using conserved domains identified through bioinformatic analysis

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged YPR142C in S. cerevisiae

    • Perform immunoprecipitation under native conditions

    • Identify co-precipitated proteins using mass spectrometry

    • Include appropriate controls to distinguish specific from non-specific interactions

  • Yeast two-hybrid screening:

    • Construct YPR142C bait plasmids

    • Screen against prey libraries derived from S. cerevisiae

    • Validate positive interactions through secondary assays

  • Proximity-based labeling:

    • Fuse YPR142C to BioID or APEX2 enzymes

    • Identify proximal proteins through biotinylation and streptavidin pulldown

    • Compare results from multiple approaches to build confidence in true interactions

These complementary methods provide a comprehensive view of the protein interaction landscape for YPR142C, offering crucial insights into its cellular function.

How should researchers design gene deletion and complementation studies for YPR142C?

Genetic manipulation studies provide critical insights into protein function. For YPR142C characterization, implement the following approach:

  • Gene deletion strategy:

    • Design deletion cassettes with antibiotic resistance markers flanked by 40-60bp homology to regions upstream and downstream of YPR142C

    • Transform S. cerevisiae using standard lithium acetate or electroporation methods

    • Select transformants on appropriate antibiotic media

    • Confirm deletion through PCR verification of both integration junctions

  • Phenotypic characterization:

    • Compare growth curves of wild-type and deletion strains in standard and stress conditions

    • Measure doubling time and lag phase differences

    • Assess metabolic profiles using techniques like metabolomics

  • Complementation studies:

    • Create expression constructs containing wild-type YPR142C under control of native or inducible promoters

    • Transform deletion strains and assess restoration of wild-type phenotypes

    • Include domain-specific mutants to identify critical functional regions

  • Advanced functional assays:

    • Perform transcriptome analysis (RNA-Seq) to identify differentially expressed genes

    • Conduct proteome analysis to detect changes in protein abundance or modification

    • Employ metabolic flux analysis to identify altered metabolic pathways

This systematic approach provides comprehensive functional characterization while establishing clear causality between genotype and phenotype.

What high-throughput screening methods are most appropriate for identifying conditions where YPR142C function is critical?

High-throughput screening approaches can rapidly identify conditions that reveal YPR142C function:

  • Chemical genomics screening:

    • Test YPR142C deletion strain against libraries of:

      • Diverse chemical compounds

      • Environmental stressors (temperature, pH, osmotic stress)

      • Nutrient limitations

    • Analyze growth characteristics using automated plate readers

    • Look for significant differences in growth rate, lag phase, or maximum density compared to wild-type

  • Synthetic genetic array (SGA) analysis:

    • Cross YPR142C deletion strain with genome-wide deletion collection

    • Identify synthetic lethal or synthetic sick interactions

    • Cluster genetic interaction profiles to predict functional relationships

  • Quantitative fitness analysis:

    • Barcode-based competitive growth assays of deletion strain in pooled cultures

    • Subject pools to various environmental conditions

    • Quantify relative abundance changes by next-generation sequencing of barcodes

  • Reporter-based screening:

    • Develop fluorescent or luminescent reporters linked to cellular pathways

    • Screen for conditions where YPR142C deletion alters reporter signal

These high-throughput approaches accelerate functional discovery by systematically testing thousands of conditions and genetic backgrounds to reveal the biological context where YPR142C function becomes essential.

How should researchers interpret transcriptomic data from YPR142C mutant strains?

Transcriptomic analysis provides valuable insights into the cellular impact of YPR142C deletion or overexpression:

  • Experimental design considerations:

    • Include biological replicates (minimum n=3) for statistical robustness

    • Control for batch effects and technical variability

    • Include time-course measurements where appropriate

    • Consider multiple environmental conditions to reveal condition-specific effects

  • Analysis pipeline:

    • Quality control: Filter low-quality reads and normalize data appropriately

    • Differential expression analysis: Identify genes with statistically significant expression changes

    • Clustering analysis: Group genes with similar expression patterns

    • Pathway enrichment: Identify biological processes affected by YPR142C mutation

  • Interpretation framework:

    • Primary effects: Genes directly regulated by YPR142C

    • Secondary effects: Downstream consequences of primary effects

    • Compensatory responses: Cellular adaptations to loss of YPR142C

    • Integration with existing knowledge: Compare to known stress responses and mutant profiles

  • Validation approaches:

    • RT-qPCR confirmation of key differentially expressed genes

    • Comparison with proteomics data to identify post-transcriptional effects

    • Functional testing of key differentially expressed genes

This comprehensive approach to transcriptomic data interpretation helps distinguish direct from indirect effects of YPR142C perturbation.

What statistical approaches should be employed when analyzing phenotypic data from YPR142C studies?

  • Growth curve analysis:

    • Fit growth curves to appropriate models (logistic, Gompertz, etc.)

    • Extract and compare parameters (doubling time, lag phase, maximum density)

    • Apply ANOVA with post-hoc tests for multi-condition comparisons

    • Use mixed-effects models for experiments with nested or repeated measures design

  • Stress response experiments:

    • Calculate EC50 values for dose-response relationships

    • Use survival analysis techniques for time-to-event data

    • Apply non-parametric tests when assumptions of normality are violated

  • Multi-omics data integration:

    • Use dimension reduction techniques (PCA, t-SNE) to visualize patterns

    • Apply network analysis to identify relationships between different data types

    • Implement machine learning approaches for pattern recognition

  • Experimental design optimization:

    • Use power analysis to determine appropriate sample sizes

    • Implement factorial or response surface designs to efficiently explore multidimensional parameter spaces

    • Control for multiple testing using appropriate corrections (Bonferroni, FDR)

How can researchers evaluate the potential of engineered YPR142C variants for biotechnological applications?

Engineering YPR142C may yield variants with enhanced properties for biotechnological applications:

  • Directed evolution strategy:

    • Create libraries of YPR142C variants through error-prone PCR or site-directed mutagenesis

    • Develop appropriate selection or screening methods based on hypothesized function

    • Iterate selection and mutagenesis to optimize desired properties

  • Functional testing framework:

    • Establish quantitative assays for relevant activities

    • Compare engineered variants against wild-type protein

    • Assess performance across diverse conditions (temperature, pH, substrate concentrations)

  • Strain engineering considerations:

    • Optimize expression levels through promoter selection and copy number

    • Consider genomic integration for stable expression

    • Evaluate effects on host metabolism and growth

  • Scale-up evaluation:

    • Test performance in laboratory-scale bioreactors

    • Assess stability and activity over extended time periods

    • Evaluate compatibility with downstream processing requirements

This systematic approach to engineering and evaluation enables development of YPR142C variants with optimized properties for specific biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.