Recombinant Saccharomyces cerevisiae Putative uncharacterized transporter YOL163W (YOL163W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
YOL163W; O0230; Putative uncharacterized transporter YOL163W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YOL163W
Target Protein Sequence
MIAWSLVATLQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWV TLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLVIGISAYFLMVPSVVQTKKP WSKKGWFTEREEKIIVNKILRDDPTKGDMNNRQGMSLKMLWQGITDYYI
Uniprot No.

Target Background

Database Links

KEGG: sce:YOL163W

STRING: 4932.YOL163W

Protein Families
Major facilitator superfamily, Allantoate permease family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Structural Features and Location

Q: What is YOL163W and what is its genomic location in Saccharomyces cerevisiae?

A: YOL163W is an open reading frame (ORF) in the yeast Saccharomyces cerevisiae that encodes a putative uncharacterized transporter of 169 amino acids. It is located on chromosome XV and belongs to the DAL5 subfamily of allantoate transporters. YOL163W is positioned in close proximity to another uncharacterized ORF, YOL162W, with only a few base pairs separating them, suggesting possible coordinated regulation. According to the Saccharomyces genome database, while these two ORFs have been proposed to potentially be a single ORF, there is a stop site between them, indicating they are separate genes .

Q: How is YOL163W expression regulated under different environmental conditions?

A: YOL163W shows distinct expression patterns under different environmental conditions, particularly in response to sulfur availability. Transcriptomic studies have revealed that YOL163W is upregulated under sulfur limitation conditions, suggesting a potential role in sulfur metabolism or homeostasis. Interestingly, in some experimental models where sulfur metabolism is perturbed, YOL163W shows an opposite expression pattern (downregulation), indicating complex regulatory mechanisms .

The promoter region of YOL163W contains binding sites for transcription factors involved in sulfur metabolism. Notably, YOL163W shares an Azf1p transcription factor binding site with the neighboring YOL162W gene, providing further evidence for coordinated regulation of these genes .

Relationship to Sulfur Metabolism

Q: What evidence suggests YOL163W is involved in sulfur metabolism?

A: Several lines of evidence implicate YOL163W in sulfur metabolism:

  • Expression profiling shows that YOL163W is upregulated under sulfur limitation conditions, similar to other genes involved in sulfur acquisition and metabolism .

  • YOL163W belongs to the DAL5 subfamily of allantoate transporters, which includes SEO1, a transporter that confers sulfoxide ethionine resistance and is thought to transport an unidentified sulfur compound .

  • YOL163W's expression patterns correlate with other sulfur metabolism genes, including YCT1 (a high-affinity cysteine transporter) and SUL1 (which directs sulfate into the cytoplasm for conversion to homocysteine) .

  • Promoter analysis has identified potential binding sites for transcription factors involved in sulfur metabolism regulation .

While these associations are suggestive, direct experimental evidence for the specific sulfur compound transported by YOL163W is still lacking.

Functional Comparison with Related Transporters

Q: How does YOL163W compare functionally to other transporters in the DAL5 subfamily?

A: Within the DAL5 subfamily of allantoate transporters, YOL163W shares similarities with several other transporters involved in nitrogen and sulfur metabolism:

  • SEO1: Another member of the DAL5 subfamily that confers resistance to sulfoxide ethionine and is proposed to transport an unidentified sulfur compound. SEO1 has a Met28p binding site in its promoter region, indicating a role in sulfur regulation .

  • YCT1: A high-affinity cysteine transporter located at the plasma membrane that plays a key role in maintaining cysteine homeostasis .

  • YOL162W: A neighboring gene that shares regulatory elements with YOL163W and is also classified in the DAL5 subfamily .

The functional overlap and differences between these transporters remain an active area of research. Unlike some other members of this family whose substrates have been identified (e.g., YCT1 transports cysteine), the specific substrate for YOL163W remains unknown, though its expression patterns suggest involvement in sulfur compound transport .

Expression Systems and Protein Production

Q: What systems are available for producing recombinant YOL163W protein for functional studies?

A: Recombinant YOL163W protein can be produced using several expression systems, with E. coli being a well-documented option. The full-length protein (169 amino acids) can be expressed with an N-terminal His tag to facilitate purification. The recommended protocol includes:

  • Expression in E. coli using appropriate vectors containing the YOL163W gene sequence fused to an N-terminal His tag.

  • Purification using affinity chromatography methods suitable for His-tagged proteins.

  • Storage in Tris/PBS-based buffer containing 6% trehalose at pH 8.0.

After purification, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

For functional studies, researchers should consider that membrane proteins like YOL163W may require specific conditions to maintain their native conformation and functionality. Alternative expression systems, such as yeast or insect cells, might be more suitable for certain applications that require proper folding and post-translational modifications .

Transcriptomic Analysis Methods

Q: What are the best methodologies for analyzing YOL163W expression in different experimental conditions?

A: For comprehensive analysis of YOL163W expression, several methodologies have been successfully employed:

  • Microarray Analysis: This has been used effectively in chemostat cultures to assess YOL163W expression across different growth conditions. The procedure involves:

    • Sampling cells from steady-state chemostat cultures

    • RNA extraction and preparation

    • Hybridization to microarrays (e.g., Affymetrix Genechip)

    • Global scaling of arrays to a target value (e.g., 150) using average signal from all gene features

    • Statistical analysis using tools like significance analysis of microarrays (SAM)

  • Real-Time Quantitative PCR (RT-qPCR): For targeted analysis of YOL163W expression, RT-qPCR offers high sensitivity and specificity.

  • RNA-Seq: This provides comprehensive transcriptome analysis with advantages over microarrays, including detection of novel transcripts and higher dynamic range.

  • Perturbation-Based Analysis: This involves perturbing steady-state growth by inducing specific transcription factors, followed by monitoring changes in YOL163W expression. This approach is particularly valuable for studying regulatory networks involving YOL163W .

For optimal results, chemostat cultivation is recommended as it allows cells to be grown to steady state at a specified growth rate before perturbation, providing a well-controlled environment for studying gene expression dynamics .

Functional Characterization Strategies

Q: What methodological approaches can help determine the substrate specificity of YOL163W?

A: Determining the substrate specificity of YOL163W requires a multi-faceted approach:

  • Transport Assays: Using radiolabeled or fluorescently labeled potential substrates to measure uptake in cells overexpressing YOL163W compared to control cells. Given its potential role in sulfur metabolism, candidates might include various sulfur-containing compounds.

  • Growth Phenotype Analysis: Testing growth of wild-type versus YOL163W deletion strains under various conditions, particularly sulfur limitation or in the presence of different sulfur sources.

  • Competitive Uptake Assays: If a substrate is identified, competitive inhibition assays with structurally related compounds can help define substrate specificity.

  • Complementation Studies: Testing whether YOL163W can functionally complement yeast strains lacking known transporters of specific compounds.

  • Metabolomic Profiling: Comparing metabolite profiles between wild-type and YOL163W mutant strains to identify accumulated or depleted compounds that might represent substrates or products of YOL163W activity.

  • Structural Modeling and Docking Simulations: Using the amino acid sequence to generate structural models and performing in silico docking studies with potential substrates .

Network Analysis and Systems Biology Approaches

Q: How can researchers integrate YOL163W into broader metabolic and regulatory networks in yeast?

A: Integrating YOL163W into broader metabolic and regulatory networks requires systems biology approaches:

  • Co-expression Analysis: Identifying genes with similar expression patterns to YOL163W across various conditions. The similarity in expression patterns between YOL163W, YOL162W, and other sulfur metabolism genes already suggests functional relationships .

  • Perturbation-Based Network Modeling: Systematically perturbing one element of a network (e.g., a transcription factor) followed by comprehensive assessment of other network elements, including YOL163W expression. This approach has been successfully used for modeling complex networks in yeast .

  • Promoter Analysis: Identifying shared transcription factor binding sites in the promoter regions of YOL163W and functionally related genes. Current research has already identified an Azf1p binding site shared between YOL163W and YOL162W .

  • Protein-Protein Interaction Studies: Using techniques such as yeast two-hybrid, co-immunoprecipitation, or proximity labeling to identify proteins that physically interact with YOL163W.

  • Metabolic Flux Analysis: Tracking the flow of metabolites through pathways potentially involving YOL163W to understand its role in cellular metabolism.

  • Hierarchical Clustering of Gene Expression Data: This can group genes with similar expression patterns across multiple conditions, helping to identify functional modules that include YOL163W .

Addressing Contradictory Expression Data

Q: How should researchers interpret contradictory YOL163W expression data between different experimental models?

A: When encountering contradictory expression data for YOL163W, researchers should consider several factors:

  • Experimental Context: The expression of YOL163W has been observed to behave differently in various models. For example, while it is upregulated under sulfur limitation, it has been reported to be downregulated in some experimental models of sulfur metabolism perturbation . This apparent contradiction may reflect:

    • Different regulatory mechanisms operating under various conditions

    • Feedback mechanisms that respond differently to acute versus chronic changes in sulfur availability

    • Differences in strain backgrounds, media compositions, or growth conditions

  • Experimental Validation: To resolve contradictions, researchers should:

    • Repeat experiments under identical conditions

    • Use multiple methodologies to measure gene expression (e.g., RT-qPCR, RNA-Seq, and protein levels)

    • Design time-course experiments to capture dynamic responses

    • Include appropriate controls and statistical analyses

  • Biological Interpretation: Seemingly contradictory results may actually reveal complex regulatory mechanisms. YOL163W may be subject to feedback inhibition, condition-specific regulation, or may function in multiple pathways with different regulatory signals .

  • Statistical Rigor: Ensure all expression data analyses include appropriate statistical methods, such as the calculation of coefficients of variation and false discovery rates, as demonstrated in previous studies of YOL163W expression .

YOL163W and YOL162W Relationship

Q: What experimental approaches can help determine whether YOL163W and YOL162W function as separate entities or as a single functional unit?

A: The close genomic proximity of YOL163W and YOL162W has raised questions about their functional relationship. To address this, researchers can employ:

  • Genetic Approaches:

    • Individual and double knockout studies to compare phenotypes

    • Complementation assays to test functional redundancy

    • Site-directed mutagenesis of the intervening stop codon to assess the effect of creating a fusion protein

  • Transcriptional Analysis:

    • High-resolution RNA-Seq to map precise transcript boundaries

    • 5' and 3' RACE (Rapid Amplification of cDNA Ends) to identify transcription start and termination sites

    • Analysis of polysome profiles to determine translation patterns

  • Promoter Studies:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to shared regulatory regions

    • Reporter assays with various promoter constructs to dissect regulatory elements

  • Evolutionary Analyses:

    • Comparative genomics across related yeast species to assess conservation patterns

    • Synteny analysis to determine if the genomic arrangement is conserved

Current evidence suggests that while YOL163W and YOL162W share common transcriptional regulation (both have an Azf1p binding site), they are separate ORFs with a stop site between them according to the Saccharomyces genome database. This structure suggests they may be functionally related but distinct entities .

Emerging Techniques for YOL163W Characterization

Q: What cutting-edge methodologies show promise for elucidating the function of YOL163W?

A: Several emerging techniques offer promising avenues for YOL163W characterization:

  • CRISPR-Cas9 Genome Editing: Precise modification of YOL163W in its native genomic context, including:

    • Introduction of specific mutations

    • Addition of reporter tags for visualization

    • Creating conditional knockouts for temporal control of expression

  • Single-Cell Transcriptomics: Analysis of YOL163W expression at the single-cell level to capture cell-to-cell variability and identify subpopulations with distinct expression patterns.

  • Cryo-EM and Advanced Structural Biology: Determination of high-resolution structures of YOL163W to provide insights into its transport mechanism and substrate binding sites.

  • Metabolic Flux Analysis with Stable Isotopes: Tracking the movement of labeled sulfur compounds to determine the specific metabolic pathways involving YOL163W.

  • Synthetic Biology Approaches: Engineering yeast strains with modified sulfur metabolism pathways to test specific hypotheses about YOL163W function.

  • Proteomics and Post-Translational Modification Analysis: Comprehensive profiling of protein modifications that might regulate YOL163W activity under different conditions.

  • Perturbation-Based Systems Biology: Combining rapid modulation of single transcription factors with genome-wide expression analysis to elucidate regulatory features involving YOL163W in complex networks .

Translational Research Potential

Q: What are the potential broader impacts of understanding YOL163W function in basic and applied research?

A: While YOL163W is currently classified as an uncharacterized transporter, elucidating its function could have several significant impacts:

  • Basic Science Understanding: Characterization of YOL163W would fill a knowledge gap in our understanding of sulfur metabolism in yeast, which serves as a model for eukaryotic cellular processes.

  • Biotechnology Applications: If YOL163W proves to be involved in sulfur compound transport, this knowledge could be leveraged for:

    • Engineering yeast strains with enhanced sulfur metabolism for bioremediation of sulfur-containing pollutants

    • Improving production of sulfur-containing compounds of industrial importance

    • Developing yeast-based biosensors for sulfur compounds

  • Comparative Biology: Understanding YOL163W function would provide insights into the evolution and functional diversification of the DAL5 transporter family across species.

  • Metabolic Engineering: Knowledge of YOL163W's role in sulfur homeostasis could inform strategies for metabolic engineering of yeast for improved production of sulfur-containing biomolecules.

  • Stress Response Understanding: Given that YOL163W expression changes under sulfur limitation, its characterization may provide insights into how cells adapt to nutrient stress, with potential parallels to stress responses in higher eukaryotes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.