Recombinant Saccharomyces cerevisiae Putative UPF0377 protein YHL045W (YHL045W)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of YHL045W Protein

YHL045W is classified as a putative UPF0377 family protein encoded in the Saccharomyces cerevisiae genome. This relatively small protein consists of 115 amino acids in its full-length form and has been assigned the UniProt identification code P38726 . The designation "putative" indicates that the protein's function has been predicted primarily through computational analysis rather than through direct experimental verification. Despite being a protein of unknown function, genomic studies have confirmed that YHL045W is not essential for yeast viability under standard laboratory conditions . This non-essential nature suggests that either the protein serves a specialized function under specific environmental conditions or that functional redundancy exists within the yeast proteome.

The UPF0377 protein family represents a group of uncharacterized proteins (UPF stands for Uncharacterized Protein Family) that share sequence similarity and are conserved across various species, suggesting potential biological significance despite the current knowledge gap regarding their specific functions. The conservation of this protein family across evolutionary distance indicates potential importance in cellular processes that have been maintained through selective pressure.

Expression in Escherichia coli

The recombinant form of YHL045W has been successfully expressed in Escherichia coli expression systems, which represents a significant advancement in studying this protein . The recombinant protein is typically produced with an N-terminal histidine tag (His-tag) to facilitate purification and detection. The expression of a yeast protein in a bacterial system demonstrates the versatility of protein production methods and enables researchers to obtain sufficient quantities of the protein for structural and functional studies.

The expression process generally involves cloning the YHL045W gene into a suitable expression vector, transforming E. coli cells, inducing protein expression, and subsequently purifying the protein using affinity chromatography techniques that exploit the His-tag fusion. The successful expression in E. coli suggests that YHL045W does not require yeast-specific post-translational modifications for proper folding, at least in its basic form.

Protein-Protein Interactions

Analysis of protein interaction networks provides valuable insights into the potential functional roles of uncharacterized proteins like YHL045W. According to the STRING protein interaction database, YHL045W shows predicted interactions with several other yeast proteins . These include:

  1. YHL050C - Another uncharacterized protein

  2. YHL050W-A - A putative UPF0479 family protein

  3. YFL066C - A helicase-like protein encoded within the telomeric Y' element

  4. YHL044W - A DUP240 family protein localized to the plasma membrane

  5. YFL064C - An uncharacterized protein

  6. YHL041W - A conserved protein of unknown function

These interaction predictions are based on various evidence types including neighborhood in the genome, gene fusion events, co-occurrence across genomes, co-expression patterns, experimental data, database annotations, and text mining of scientific literature . The interaction with YHL050W-A, another UPF family protein, suggests potential functional relationships within these uncharacterized protein families.

Potential Cellular Functions

While the precise function of YHL045W remains to be elucidated, several hypotheses can be formulated based on its characteristics and interaction patterns:

  1. Membrane-associated function: The hydrophobic regions in its sequence suggest potential membrane association, which could indicate roles in membrane integrity, transport, or signaling.

  2. Stress response involvement: Many non-essential yeast proteins are involved in stress response pathways. YHL045W might play a role under specific stress conditions not typically encountered in laboratory settings.

  3. Telomere-related functions: The predicted interaction with YFL066C, a helicase-like protein encoded within telomeric regions, hints at potential involvement in telomere maintenance or regulation.

  4. Regulatory roles: The protein may serve as a cofactor or regulatory element in cellular processes, functioning in conjunction with its interaction partners.

It's important to note that these functional hypotheses remain speculative until verified through direct experimental evidence. The non-essential nature of YHL045W in standard growth conditions suggests either functional redundancy or specialization for specific environmental conditions.

Current Research Applications

The recombinant YHL045W protein serves as a valuable tool for various research applications:

  1. Structural studies: The availability of purified recombinant protein enables structural determination through techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy.

  2. Antibody development: Recombinant YHL045W can be used to generate specific antibodies for detection and localization studies within yeast cells.

  3. Interaction validation: The protein can be employed in pull-down assays, co-immunoprecipitation experiments, or yeast two-hybrid screens to validate predicted protein interactions.

  4. Functional characterization: In vitro biochemical assays using the purified protein can help identify potential enzymatic activities or binding properties.

Future Research Directions

Several promising avenues exist for further investigation of YHL045W:

  1. Comprehensive deletion and overexpression studies: While YHL045W is non-essential under standard conditions, phenotypic analysis under various stress conditions might reveal specific requirements for this protein.

  2. Localization studies: Determining the subcellular localization of YHL045W using fluorescent protein fusions or immunofluorescence could provide insights into its functional context.

  3. Evolutionary analysis: Comparative genomics across different yeast species and other fungi could reveal patterns of conservation and functional constraints on the UPF0377 family.

  4. Structural determination: Resolving the three-dimensional structure would significantly advance understanding of potential functional mechanisms and interaction surfaces.

  5. Systems biology approaches: Integration of proteomics, transcriptomics, and metabolomics data could place YHL045W within broader cellular networks and pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YHL045W; Putative UPF0377 protein YHL045W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YHL045W
Target Protein Sequence
MKMLLFLNEACIFIDSVCEGIVFWGLCLFVCAECGNAYYRGARVPYKTLFRAFEVSVFGQ KEYPNFRFGPSYRFLCLSPYSICCKQPPMEEVILYYPSPDSLIKNRKRVLGVAYL
Uniprot No.

Target Background

Database Links

STRING: 4932.YHL045W

Protein Families
UPF0377 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YHL045W and where is it located in the S. cerevisiae genome?

YHL045W is a putative protein of unknown function (UPF0377) in Saccharomyces cerevisiae. It is located on chromosome VIII and is adjacent to YHL044W, which belongs to the DUP240 multigene family. The conservation of synteny between YHL045W and YHL044W has been observed across multiple S. cerevisiae strains, indicating a possible functional or evolutionary relationship between these genes. The chromosomal context of YHL045W appears to be relatively stable, with the notable exception of strain K1, where chromosomal rearrangement has been observed affecting the YHL044W locus .

What is currently known about the function of YHL045W?

YHL045W encodes a putative protein of the UPF0377 family whose precise function remains uncharacterized. The protein is conserved within the Saccharomyces genus, suggesting it may play a role specific to these yeasts. Based on its genomic context, particularly its proximity to YHL044W (a member of the DUP240 family), researchers hypothesize it may be involved in membrane processes or cellular communication. Current research approaches include comparative genomics, phenotypic analysis of deletion mutants, and protein interaction studies to elucidate its function.

How does YHL045W relate to the DUP240 gene family?

While YHL045W itself is not classified as a member of the DUP240 gene family, its chromosomal proximity to YHL044W (which is a DUP240 family member) suggests possible functional relationships or co-regulation patterns. The DUP240 family consists of 10 paralogs in S. cerevisiae strain S288C, with seven organized as tandem repeats and three as solo ORFs (YAR023c, YCR007c, and YHL044w) . The conservation of synteny between YHL045W and YHL044W across multiple strains may indicate selective pressure to maintain this genomic arrangement, possibly due to shared regulatory elements or functional interactions.

What expression vectors are recommended for recombinant production of YHL045W?

For recombinant expression of YHL045W, several vector systems can be employed depending on the experimental objectives:

  • Yeast-based expression systems:

    • pYES2/CT (galactose-inducible)

    • pRS series (constitutive or regulated expression)

    • pGREG series (Gateway-compatible for C- or N-terminal tagging)

  • E. coli expression systems:

    • pET series vectors (particularly pET28a with His-tag)

    • pGEX vectors (for GST fusion proteins)

When selecting an expression system, consider whether native post-translational modifications are essential for your study. For structural studies or antibody production, E. coli systems may be sufficient, while functional studies might require expression in yeast to ensure proper folding and modifications.

What are the optimal growth conditions for studying YHL045W expression in S. cerevisiae?

The optimal growth conditions for studying YHL045W expression involve both standard and specialized approaches:

  • Standard conditions: YPD medium (1% yeast extract, 2% peptone, 2% glucose) at 30°C with shaking at 250 rpm

  • Carbon source variations: Compare expression levels in glucose, galactose, and non-fermentable carbon sources like glycerol to identify regulation patterns

  • Growth phases: Monitor expression during lag, log, and stationary phases using RT-qPCR

  • Stress conditions: Examine expression under osmotic stress, oxidative stress, and nutrient limitation

When monitoring expression, it's advisable to use epitope-tagged versions of YHL045W (such as HA or FLAG tags) to facilitate detection by Western blotting, as specific antibodies against this protein may not be commercially available. Time-course experiments that sample at multiple points during growth can reveal patterns of expression that may provide functional insights.

What phenotypes are associated with YHL045W deletion mutants?

Studies of YHL045W deletion mutants have not revealed strong phenotypes under standard laboratory conditions, suggesting potential genetic redundancy or a specialized function that becomes evident only under specific conditions. Systematic phenotypic screening should include:

  • Growth rate analysis in various media compositions

  • Stress response assays (temperature, pH, oxidative, osmotic)

  • Cell morphology examination

  • Cell wall integrity tests

  • Membrane permeability assays

Researchers should consider creating double or triple deletion mutants with functionally related genes, particularly with adjacent genes like YHL044W, to uncover phenotypes masked by genetic redundancy. High-throughput approaches such as synthetic genetic array (SGA) analysis can identify genetic interactions that may provide functional insights.

How can I determine if YHL045W is subject to allelic recombination similar to other genes in the region?

To investigate whether YHL045W undergoes allelic recombination similar to what has been observed for adjacent genes like YHL044W, implement a multi-faceted approach:

  • Sequence analysis across multiple strains:

    • PCR amplify and sequence YHL045W from diverse S. cerevisiae strains

    • Construct phylogenetic networks rather than trees to visualize potential recombination events

    • Apply statistical tests for recombination (e.g., GARD, RDP4)

  • Diploid heterozygosity analysis:

    • Examine naturally heterozygous diploid strains (like YIIc12 and YIIc17 which show heterozygosity in YHL044W)

    • Induce sporulation and analyze segregation patterns

    • Use SNP markers to track inheritance patterns

  • Experimental evolution approaches:

    • Maintain mixed populations of tagged YHL045W variants under selective pressure

    • Sequence at intervals to detect recombination events

    • Compare recombination rates with control loci

When analyzing sequence data, pay particular attention to mosaic patterns that may indicate recombination breakpoints. The observed heterozygosity patterns in strains like YIIc12 and YIIc17 for YHL044W suggest that similar analyses for YHL045W could reveal valuable evolutionary insights .

What is the evolutionary rate of YHL045W compared to adjacent genes and other S. cerevisiae genes?

To determine the evolutionary rate of YHL045W and compare it to other genes:

  • Comparative sequence analysis:

    • Sequence YHL045W from multiple S. cerevisiae strains and closely related Saccharomyces species

    • Calculate synonymous (dS) and non-synonymous (dN) substitution rates

    • Determine dN/dS ratios to assess selective pressure

  • Reference point comparison:

    • Compare evolutionary rates with adjacent genes like YHL044W

    • Include both Ascomycetes-specific genes and common genes as reference points

    • Based on findings from DUP240 family studies, Ascomycetes-specific genes appear to be diverging faster than common genes

  • Sliding window analysis:

    • Perform sliding window analysis of nucleotide diversity to identify regions under different selective pressures

    • Map these regions to predicted functional domains of the protein

The evolutionary analysis should be structured as follows:

Gene CategoryExample GenesAvg. dN/dSInterpretation
YHL045W-TBDTo be determined in your study
Adjacent DUP240 familyYHL044WHigher valuesFaster evolution, possibly due to positive selection
Ascomycetes-specificVariousIntermediateLineage-specific adaptations
Common (conserved) genesVariousLower valuesEvolutionary constraint due to essential functions

A network-based phylogenetic approach, rather than simple tree construction, would better capture the complex evolutionary history that may include both point mutations and recombination events.

How can I determine the subcellular localization and potential protein interactions of YHL045W?

Determining the subcellular localization and protein interactions of YHL045W requires multiple complementary approaches:

  • Fluorescent protein fusion strategies:

    • Create both C- and N-terminal GFP fusions to avoid disrupting localization signals

    • Use monomeric fluorescent proteins to minimize artifacts

    • Implement inducible expression systems to prevent mislocalization due to overexpression

    • Compare localization under various growth conditions and stress responses

  • Biochemical fractionation:

    • Perform subcellular fractionation followed by Western blotting

    • Use multiple fractionation protocols to confirm results

    • Include known marker proteins for each cellular compartment as controls

  • Protein interaction studies:

    • Implement BioID or APEX proximity labeling to identify neighboring proteins

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Conduct yeast two-hybrid screening with appropriate controls

    • Validate key interactions using FRET or BiFC approaches

If YHL045W follows patterns similar to the adjacent DUP240 family member YHL044W, it may be associated with membrane compartments. The DUP240 family has been implicated in membrane processes, suggesting that YHL045W might have related functions despite not being a direct family member.

What is the recommended protocol for generating a YHL045W knockout strain?

Creating a precise YHL045W knockout strain requires careful consideration of its genomic context near YHL044W. Here is a detailed protocol:

  • Design of deletion cassette:

    • Select a marker gene appropriate for your strain background (e.g., KanMX for resistance to G418)

    • Design primers with 40-60bp homology to sequences flanking YHL045W

    • Include unique restriction sites for verification

    • Consider the proximity to YHL044W to avoid disrupting its regulation

  • Transformation procedure:

    • Prepare competent cells from log-phase cultures

    • Transform with lithium acetate/PEG method

    • Plate on selective media

    • Incubate at 30°C for 2-3 days

  • Verification of knockout:

    • Colony PCR using primers outside the targeted region

    • Diagnostic restriction digestion

    • Sequencing of junction regions

    • RT-PCR to confirm absence of YHL045W transcript

    • Optional: Western blotting if antibodies are available

  • Phenotypic confirmation:

    • Compare growth rates in different media with wild-type strain

    • Test for specific phenotypes based on predicted function

    • Consider complementation tests to confirm phenotype is due to YHL045W deletion

When generating knockouts of genes with potentially overlapping functions, consider creating double or triple knockouts. Based on the genomic proximity of YHL045W to YHL044W, it may be particularly informative to create a double knockout to test for synthetic phenotypes that might reveal functional relationships .

How should I design experiments to investigate the impact of allelic variation in YHL045W?

To investigate the impact of allelic variation in YHL045W:

  • Collection and characterization of natural variants:

    • Sequence YHL045W from diverse S. cerevisiae strains (industrial, wild, clinical)

    • Create an allele table documenting amino acid substitutions

    • Use comparative modeling to predict functional impacts

    • Classify variants by predicted effect (neutral, mild, severe)

  • Allele replacement experiments:

    • Use CRISPR-Cas9 or delitto perfetto for scarless allele replacement

    • Replace the native allele with variants of interest

    • Include appropriate controls (restoration of original sequence)

    • Create a standardized strain set with identical backgrounds differing only in YHL045W allele

  • Phenotypic characterization:

    • Implement high-throughput phenotypic assays

    • Include environmentally relevant stress conditions

    • Measure growth rates, metabolic outputs, and cellular morphology

    • Conduct global gene expression analysis to identify downstream effects

  • Protein-level characterization:

    • Express and purify variant proteins

    • Assess stability, folding, and post-translational modifications

    • Determine if variants affect protein-protein interactions

A systematic analysis of natural variation can provide insights into functionally important regions of the protein. Given the observation in related genes like YHL044W that allelic recombination contributes significantly to sequence evolution , investigating whether similar patterns exist in YHL045W could reveal important evolutionary mechanisms.

What approaches can be used to determine if YHL045W forms protein complexes?

To investigate whether YHL045W participates in protein complexes:

  • Affinity purification coupled with mass spectrometry:

    • Create strains expressing epitope-tagged YHL045W (FLAG, HA, TAP)

    • Optimize lysis conditions to preserve protein complexes

    • Perform tandem affinity purification

    • Analyze via LC-MS/MS to identify interacting partners

    • Include appropriate controls (untagged strain, irrelevant tagged protein)

  • Size exclusion chromatography:

    • Prepare native cell extracts under non-denaturing conditions

    • Fractionate proteins by size

    • Detect YHL045W in fractions using Western blotting

    • Compare elution profile with known size standards

    • Analyze co-eluting proteins by mass spectrometry

  • Blue native PAGE:

    • Separate native protein complexes by electrophoresis

    • Perform Western blotting to detect YHL045W

    • Excise bands for protein identification

    • Compare with SDS-PAGE to determine complex composition

  • Cross-linking mass spectrometry:

    • Treat cells with protein cross-linkers

    • Enrich for YHL045W-containing complexes

    • Digest and analyze by mass spectrometry

    • Identify cross-linked peptides to map interaction interfaces

The comparative analysis with the adjacent YHL044W protein from the DUP240 family might be particularly informative. If YHL045W and YHL044W are found in the same complex, this would support functional cooperation between these adjacently encoded proteins .

What statistical approaches are recommended for analyzing YHL045W expression data across multiple strains?

When analyzing YHL045W expression data across multiple S. cerevisiae strains:

  • Normalization strategies:

    • Employ multiple reference genes (e.g., ACT1, PGK1, TDH3) for RT-qPCR normalization

    • Use spike-in controls for RNA-seq data

    • Apply quantile normalization for microarray data

    • Calculate relative expression using the 2^-ΔΔCt method for RT-qPCR

  • Statistical tests:

    • ANOVA with post-hoc tests for multiple strain comparisons

    • Non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

    • Linear mixed models to account for batch effects

    • FDR correction for multiple testing

  • Visualization approaches:

    • Heatmaps for expression patterns across conditions

    • Principal component analysis to identify strain clustering

    • Volcano plots to highlight significant differences

    • Network analysis to visualize co-expression patterns

  • Correlation analyses:

    • Correlate YHL045W expression with adjacent genes like YHL044W

    • Examine co-expression patterns across environmental conditions

    • Perform gene set enrichment analysis to identify functionally related genes

When interpreting expression data, consider that genes in proximity like YHL044W and YHL045W may exhibit coordinated expression due to shared regulatory elements. The conservation of synteny observed for these genes across multiple strains suggests potential functional relationships that might be reflected in expression patterns .

How should I interpret evolutionary analyses of YHL045W in the context of the surrounding genomic region?

Interpreting evolutionary analyses of YHL045W requires consideration of its genomic context:

  • Synteny analysis interpretation:

    • Conservation of synteny across strains suggests functional constraints

    • Disruptions in synteny (as seen with YHL044W in strain K1) may indicate genomic plasticity in certain lineages

    • Compare synteny patterns with genes of known function to generate functional hypotheses

  • Sequence variation patterns:

    • Elevated dN/dS ratios in specific domains suggest positive selection

    • Conservation across species indicates functional importance

    • Mosaic patterns may indicate recombination events

    • Compare evolutionary rates with Ascomycetes-specific genes vs. common genes

  • Evolutionary network analysis:

    • Interpret network-based phylogenies to identify potential recombination events

    • Look for evidence of heterozygosity as seen in YHL044W in strains YIIc12 and YIIc17

    • Consider horizontal gene transfer as a possible evolutionary mechanism

  • Functional interpretation:

    • Correlate evolutionary patterns with predicted protein domains

    • Identify rapidly evolving regions as potential interaction interfaces

    • Use evolutionary conservation to guide functional studies

The comparative analysis with adjacent genes like YHL044W provides valuable context. Research has shown that DUP240 family members like YHL044W show different rates of evolution, with some paralogs fixing mutations more easily than others . Determining whether YHL045W follows similar patterns can provide insights into its functional importance and evolutionary constraints.

What approaches can resolve contradictory results from different experimental methods studying YHL045W?

When faced with contradictory results in YHL045W research:

  • Systematic validation approaches:

    • Replicate experiments using alternative methodologies

    • Vary experimental conditions to identify context-dependent effects

    • Use orthogonal techniques to verify key findings

    • Implement controls to identify potential artifacts

  • Technical considerations:

    • Evaluate tag interference in protein localization or interaction studies

    • Consider strain background effects on phenotypes

    • Assess growth conditions that might influence results

    • Review detection limits of different methodologies

  • Integrative analysis frameworks:

    • Implement Bayesian approaches to integrate data from multiple sources

    • Use weighted evidence models based on methodological robustness

    • Conduct meta-analysis of replicated experiments

    • Develop computational models to reconcile divergent findings

  • Resolution strategies for specific contradictions:

    Contradiction TypeExampleResolution Approach
    Localization discrepanciesDifferent subcellular patterns with N- vs. C-terminal tagsCreate internal tags; use split-GFP approaches
    Phenotypic inconsistenciesGrowth defects observed in some but not all studiesStandardize growth conditions; use quantitative phenotyping
    Interaction partner differencesDistinct interactors identified by Y2H vs. AP-MSImplement proximity labeling; validate key interactions independently
    Expression pattern variationsDifferent expression patterns across studiesStandardize reference genes; use absolute quantification methods

When interpreting conflicting data, consider that the adjacent gene YHL044W shows strain-specific evolutionary patterns , suggesting YHL045W might similarly exhibit strain-specific properties that could explain experimental discrepancies.

What are the main technical challenges in studying YHL045W and how can they be overcome?

Studying YHL045W presents several technical challenges with specific solutions:

  • Low expression levels:

    • Implement more sensitive detection methods (nanoluciferase tags)

    • Use stronger promoters for experimental constructs

    • Enrich for relevant cell types or growth conditions where expression may be higher

    • Employ single-molecule detection techniques for localization studies

  • Potential functional redundancy:

    • Create multiple gene knockouts in related pathways

    • Use conditional alleles to bypass potential lethality

    • Implement synthetic genetic interaction screening

    • Apply environmental stresses to reveal condition-specific phenotypes

  • Lack of known functional domains:

    • Utilize structure prediction algorithms (AlphaFold2)

    • Perform systematic mutagenesis to identify functional regions

    • Create chimeric proteins with related genes to identify critical domains

    • Implement evolutionary coupling analysis to predict functional sites

  • Limited availability of specific reagents:

    • Develop custom antibodies against unique peptide regions

    • Validate commercial antibodies against knockout controls

    • Use epitope tagging approaches with verified functional validation

    • Establish CRISPR-based endogenous tagging protocols

The challenges in studying uncharacterized yeast proteins like YHL045W are similar to those encountered with the DUP240 family members. Leveraging the methodologies that successfully revealed insights into the evolution and function of the adjacent YHL044W gene can provide a roadmap for YHL045W research .

How should I design experiments to determine if YHL045W contributes to phenotypes associated with nearby genes?

To investigate potential functional relationships between YHL045W and nearby genes like YHL044W:

  • Genetic interaction analysis:

    • Create single and double knockout combinations (ΔyhL045W, ΔyhL044W, ΔyhL045W ΔyhL044W)

    • Implement quantitative fitness analysis across environmental conditions

    • Apply the concept of genetic interaction scores (ε = WAB - WA × WB)

    • Look for synthetic lethal, synthetic sick, or epistatic relationships

  • Transcriptional analysis:

    • Analyze expression correlation between YHL045W and nearby genes

    • Perform RNA-seq on single gene knockouts to identify compensatory responses

    • Investigate shared transcription factor binding sites

    • Determine if gene deletions affect neighboring gene expression

  • Protein-level investigations:

    • Test for physical interactions between protein products

    • Investigate co-localization patterns

    • Examine if protein stability of one affects the other

    • Determine if they participate in the same cellular pathways

  • Functional complementation:

    • Test if overexpression of one gene can rescue phenotypes of the other's deletion

    • Create chimeric proteins to identify functional domains

    • Express orthologs from related species to test functional conservation

    • Implement domain swapping experiments

The conservation of synteny between YHL045W and YHL044W across multiple S. cerevisiae strains suggests potential functional relationships . Experimental designs should consider this genomic context when interpreting results, particularly when phenotypes might be subtle due to functional redundancy.

What are the best practices for publishing research on poorly characterized proteins like YHL045W?

When publishing research on poorly characterized proteins like YHL045W:

  • Comprehensive characterization approach:

    • Provide multiple lines of evidence for functional assignments

    • Include negative results that exclude alternative hypotheses

    • Present evolutionary context across strains and species

    • Connect findings to broader biological processes

  • Methodological transparency:

    • Describe all experimental conditions in detail

    • Deposit full datasets in appropriate repositories

    • Include all control experiments

    • Provide detailed protocols as supplementary material

    • Share strain and plasmid resources with the community

  • Appropriate contextualization:

    • Discuss findings in relation to known information about genomic neighbors like YHL044W

    • Compare evolutionary patterns with both Ascomycetes-specific and common genes

    • Connect to systems-level data (protein interaction networks, metabolic pathways)

    • Highlight remaining questions and limitations

  • Community standards compliance:

    • Follow nomenclature guidelines for newly identified functions

    • Deposit sequences in appropriate databases

    • Update genome annotation resources with new findings

    • Contribute to community resources like Saccharomyces Genome Database

When publishing on YHL045W, be particularly careful to distinguish between direct experimental evidence and inferences based on its genomic proximity to better-characterized genes like YHL044W. The observed patterns of differential evolution and conservation of synteny in the region provide valuable context for functional hypotheses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.