Recombinant Saccharomyces cerevisiae Putative UPF0479 protein YJL225W-A (YJL225W-A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
YJL225W-A; Putative UPF0479 protein YJL225W-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL225W-A
Target Protein Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSTFLERFHNNRIVFCLPFFLALFFVPVQKVLQH LCLRFTQVAPYFKIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV DLSPFYAKIFQISYRVPMIWLDVFQVFFVFLVISQHSLHS
Uniprot No.

Target Background

Protein Families
UPF0479 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YJL225W-A and what are its key characteristics?

YJL225W-A is a putative protein belonging to the UPF0479 family in Saccharomyces cerevisiae. According to available data, it is a relatively small protein consisting of 160 amino acids in full length . While comprehensive functional characterization remains limited, structural analysis indicates it belongs to a conserved protein family with potential functional significance in yeast cellular processes.

For initial characterization, researchers should employ:

  • Sequence homology analysis against characterized proteins

  • Bioinformatic prediction of functional domains

  • Expression profiling under various growth conditions

  • Preliminary structural prediction analysis

What expression systems are optimal for recombinant production of YJL225W-A?

Based on available data, YJL225W-A has been successfully expressed as a recombinant protein in E. coli with a His-tag fusion for purification . When selecting an expression system, consider these methodological approaches:

Expression SystemAdvantagesConsiderationsApplication
E. coliHigh yield, rapid growth, established protocolsPotential improper folding, limited PTMsInitial characterization, structural studies
S. cerevisiaeNative environment, proper folding, natural PTMsLower yields, longer growth periodFunctional studies, interaction analysis
Insect cellsAdvanced eukaryotic PTMs, good yieldMore complex protocols, higher costPTM studies, conformational analysis

For experimental design considerations:

  • Optimize codon usage for the selected expression system

  • Test multiple fusion tags (His, GST, MBP) for improved solubility

  • Evaluate expression under various induction conditions

  • Implement quality control measures via SDS-PAGE and Western blot analysis

How should researchers design experimental controls when studying YJL225W-A function?

When designing experiments to investigate YJL225W-A function, proper controls are essential for result validation:

  • Negative controls:

    • Empty vector transformants

    • Expression of an unrelated protein of similar size

    • Wild-type strains without genetic modification

  • Positive controls:

    • Well-characterized proteins from the same family (if available)

    • Tagged version of a known protein using identical methodology

    • Validated assay systems with established outcomes

  • Experimental validation approaches:

    • Multiple independent transformants/clones analysis

    • Replicate experiments with varied conditions

    • Complementary methodologies to confirm key findings

Following experimental design principles from established literature will ensure rigorous and reproducible results .

What purification strategy is most effective for obtaining high-purity YJL225W-A protein?

For optimal purification of recombinant YJL225W-A, implement a multi-step approach:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Gentle cell lysis conditions to maintain protein structure

    • Inclusion of protease inhibitors during extraction

  • Secondary purification:

    • Size exclusion chromatography for homogeneity

    • Ion exchange chromatography for charge variant separation

    • Affinity chromatography with specific ligands if applicable

  • Buffer optimization matrix:

Buffer ComponentRecommended RangePurpose
pH6.5-8.0Maintain native conformation
NaCl150-300 mMReduce non-specific interactions
Glycerol5-10%Enhance stability during storage
Reducing agent1-5 mM DTT/BMEPrevent oxidation of cysteines
  • Quality assessment:

    • SDS-PAGE for purity evaluation (>95% recommended)

    • Western blot for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Dynamic light scattering for homogeneity analysis

How can researchers effectively design CRISPR-based experiments to study YJL225W-A function?

For CRISPR-based functional studies of YJL225W-A, implement the following methodological workflow:

  • gRNA design considerations:

    • Target sequences with minimal off-target potential

    • Design multiple gRNAs targeting different regions

    • Consider target accessibility in chromatin context

    • Evaluate potential for homology-directed repair if inserting tags

  • Experimental approaches:

    • Complete gene deletion for loss-of-function analysis

    • N- or C-terminal tagging for localization studies

    • Point mutations for structure-function analysis

    • Conditional expression systems for essential gene studies

  • Validation strategy:

    • PCR confirmation of intended modifications

    • Sequencing to verify precise editing

    • Expression analysis via RT-qPCR and Western blotting

    • Phenotypic characterization under multiple conditions

  • Analysis of complex phenotypes:

    • Growth rate measurements under various conditions

    • Metabolic profiling using mass spectrometry

    • Transcriptomic analysis to identify downstream effects

    • Microscopy to assess morphological changes

This approach follows established experimental design principles for genetic manipulation in yeast systems .

What methodological considerations are important when implementing SMART designs for studying adaptive interventions in YJL225W-A research?

When implementing Sequential Multiple Assignment Randomized Trial (SMART) designs for studying adaptive intervention strategies in YJL225W-A research, consider these methodological principles:

  • Key design elements:

    • Define clear tailoring variables (e.g., expression level thresholds)

    • Determine decision points based on measurable outcomes

    • Establish intervention options at each stage

    • Identify primary and secondary endpoints

  • Implementation framework:

    • Stage 1: Initial intervention (e.g., different expression conditions)

    • Assessment of intermediate outcomes

    • Stage 2: Adaptive intervention based on response to initial treatment

    • Final outcome measurement

  • Analysis considerations:

    • Compare effectiveness of intervention options at different stages

    • Evaluate embedded adaptive interventions

    • Account for sequential randomization in statistical models

    • Consider potential time-varying confounders

This approach adapts the SMART methodology from clinical research to molecular biology applications, allowing for systematic optimization of experimental conditions for YJL225W-A characterization .

How can researchers identify and characterize the interaction network of YJL225W-A?

For comprehensive mapping of YJL225W-A protein interactions, implement these complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged YJL225W-A under native conditions

    • Perform gentle lysis and immunoprecipitation

    • Identify co-purifying proteins by mass spectrometry

    • Apply statistical filters to distinguish specific interactions from contaminants

  • Yeast two-hybrid screening:

    • Construct bait plasmids with YJL225W-A

    • Screen against genomic or ORFeome prey libraries

    • Validate interactions through secondary assays

    • Map interaction domains through deletion constructs

  • Proximity-based labeling approaches:

    • Generate BioID or TurboID fusion constructs

    • Identify proteins in proximal space through biotinylation

    • Compare with control samples for specificity

    • Map subcellular interaction domains

  • Interaction network analysis:

Analysis ApproachMethodExpected Outcome
GO term enrichmentStatistical overrepresentationBiological processes associated with interactors
Network visualizationCytoscape or similar toolsVisual representation of protein complexes
Domain analysisMotif/domain scanningCommon interaction interfaces
Cross-species comparisonOrtholog identificationEvolutionary conservation of interactions

What strategies can researchers employ to investigate potential post-translational modifications of YJL225W-A?

For comprehensive analysis of YJL225W-A post-translational modifications (PTMs), implement this systematic approach:

  • Sample preparation considerations:

    • Isolate protein under native conditions to preserve in vivo modifications

    • Include phosphatase and deacetylase inhibitors during extraction

    • Prepare samples from various growth conditions and stress responses

    • Generate both bottom-up (peptide) and top-down (intact protein) preparations

  • Mass spectrometry-based identification:

    • Employ enrichment strategies for specific PTM types

    • Use fragmentation methods optimized for PTM detection

    • Implement database searching with variable modification parameters

    • Quantify modification stoichiometry when possible

  • PTM-specific analytical approaches:

PTM TypeEnrichment StrategyDetection MethodValidation Approach
PhosphorylationTiO₂ or IMACLC-MS/MS with neutral loss scanningPhospho-specific antibodies, phosphatase treatment
GlycosylationLectin affinityETD/EThcD fragmentationPNGase F treatment, glycan profiling
UbiquitinationK-ɛ-GG antibodiesTryptic digestion with remnant detectionProteasome inhibition, ubiquitin mutants
AcetylationAnti-acetyl lysineHigh-resolution MSHDAC inhibitors, site-directed mutagenesis
  • Functional validation:

    • Generate site-directed mutants of modified residues

    • Analyze phenotypic consequences of mutation

    • Investigate temporal dynamics of modifications

    • Identify enzymes responsible for modification/demodification

How should researchers design experiments to determine the structure-function relationship of YJL225W-A?

To systematically investigate structure-function relationships in YJL225W-A, implement this comprehensive strategy:

  • Structural determination approaches:

    • X-ray crystallography of purified protein

    • NMR spectroscopy for solution structure

    • Cryo-EM for larger complexes

    • Computational prediction and modeling as preliminary guide

  • Structure-guided mutagenesis:

    • Conserved residue identification through multiple sequence alignment

    • Domain boundary determination through limited proteolysis

    • Alanine-scanning mutagenesis of potential functional sites

    • Chimeric constructs with homologous proteins

  • Functional assay development:

    • Growth phenotype analysis under various conditions

    • Protein-protein interaction assessment before and after mutation

    • Subcellular localization determination

    • Biochemical activity assays if enzymatic function is suspected

  • Advanced structural analysis techniques:

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cross-linking mass spectrometry for interaction interfaces

    • SAXS for solution conformation

    • Molecular dynamics simulations for conformational flexibility

Proteinase A from S. cerevisiae provides an excellent model for structural characterization methodology that can be applied to YJL225W-A research .

How can YJL225W-A be utilized in recombinant yeast-based immunotherapy research?

YJL225W-A can be incorporated into yeast-based immunotherapy platforms through these methodological approaches:

  • Expression system design:

    • Whole recombinant Saccharomyces cerevisiae expressing YJL225W-A

    • Heat-killed yeast preparations maintaining antigenic epitopes

    • Surface display systems for enhanced immune recognition

    • Multi-epitope constructs combining YJL225W-A with other antigens

  • Immunological assessment:

    • T-cell proliferation assays in response to yeast-expressed YJL225W-A

    • Cytokine profiling to characterize immune response quality

    • Antibody generation and characterization

    • Antigen presentation analysis with dendritic cells

  • Experimental design considerations:

    • Dose escalation studies to determine optimal immunogenic dose

    • Repeated administration protocols to assess boosting effects

    • Evaluation in relevant animal models

    • Assessment of mutation-specific responses if applicable

This approach adapts established yeast-based immunotherapy methodologies that have shown promise in cancer immunotherapy applications .

What analytical methods are most appropriate for evaluating immune responses to YJL225W-A in experimental models?

For comprehensive immune response evaluation to YJL225W-A, implement these analytical approaches:

  • T cell response assessment:

    • Proliferation assays using tritiated thymidine incorporation

    • ELISPOT for cytokine-producing cells quantification

    • Flow cytometry for phenotypic characterization

    • TCR repertoire analysis for clonal expansion

  • Antibody response evaluation:

    • ELISA for antibody titer determination

    • Western blot for epitope recognition patterns

    • Avidity assessment through chaotropic ELISAs

    • Functional antibody assays if applicable

  • Antigen presentation analysis:

    • MHC-peptide complex detection

    • Dendritic cell activation status measurement

    • Cross-presentation assessment

    • In vitro T cell stimulation with loaded APCs

  • Data analysis considerations:

Analysis ApproachMetricsApplication
Dose-responseEC50, maximum responseOptimal dose determination
KineticsTime to peak, response durationScheduling optimization
ComparisonsFold-change, statistical significanceAdjuvant/formulation selection
CorrelationImmune parameters vs. protectionSurrogate marker identification

This comprehensive analytical framework adapts methodologies from immunological studies of yeast-based therapeutics .

What approaches should researchers use to analyze evolutionary conservation of YJL225W-A across fungal species?

To investigate evolutionary aspects of YJL225W-A, implement this systematic comparative genomics approach:

  • Homology identification:

    • BLAST/PSI-BLAST searches against fungal genome databases

    • Hidden Markov Model construction for remote homolog detection

    • Synteny analysis to identify positional orthologs

    • Paralog identification within S. cerevisiae

  • Evolutionary rate analysis:

    • dN/dS calculations to detect selection pressure

    • Sliding window analysis for domain-specific evolution

    • Branch-site models for lineage-specific selection

    • Coevolution analysis with interacting partners

  • Structural conservation assessment:

    • Multiple sequence alignment of identified homologs

    • Secondary structure prediction comparison

    • Tertiary structure modeling and comparison

    • Functional site conservation mapping

  • Functional divergence investigation:

    • Complementation studies across species

    • Heterologous expression phenotypic analysis

    • Domain swapping experiments

    • Transcriptional regulation comparison

This approach can reveal important insights into the evolutionary history and functional constraints of YJL225W-A, providing context for experimental findings.

How can adaptive intervention methodologies be applied to optimize YJL225W-A expression and purification?

Applying adaptive intervention principles to YJL225W-A expression and purification enables systematic optimization:

  • Sequential decision points:

    • Initial expression system selection

    • Mid-course evaluation of expression levels

    • Secondary intervention based on protein solubility

    • Final optimization based on functional activity

  • Tailoring variables:

    • Expression level thresholds

    • Solubility percentages

    • Purity metrics

    • Activity measurements

  • Stage-specific interventions:

    StageAssessment CriteriaPotential Interventions
    Initial expressionDetectable proteinChange vector, host strain, fusion tag
    Solubility evaluation>30% soluble fractionModify lysis conditions, add solubilizing agents
    Purification assessment>90% purityAdditional chromatography steps, buffer optimization
    Activity determinationFunctional assay resultsRefolding protocols, stabilizing additives
  • Analysis approach:

    • Compare effectiveness of intervention sequences

    • Identify optimal decision rules at each stage

    • Develop adaptive protocols for future production

This methodology adapts principles from sequential multiple assignment randomized trials (SMART) to protein production optimization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.