Recombinant Saccharomyces cerevisiae Regulator of rDNA transcription protein 6 (RRT6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
RRT6; YGL146C; Regulator of rDNA transcription protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RRT6
Target Protein Sequence
MEKASLNIAQTKEIPLTDRRMGLRGWKACSRPHLLGRILLFMSILFITSAELSSDVSSRE VYMPIFNNKLSFKVPPIKRSLLLGAALYEDFEYSSNNSASDGAFCTVFNAGMNDASREVV FEIHVMDVLQEETDSSRFGGTSHERGRQSLGFSVFNNKNGDLLRSKKNLASGTSVIEVNP GNCNEFLICFINLVYDGSWSSIDTEKSVTIKMTYNDKLDPDMLLHLVNQMTPQVVKALNT VSDGLFQIVSDTTLLQMESDRRDINEATYSYLIVGFVSLMVAQLISNIIVTTYLIIKIKS NPSSHIKKKGL
Uniprot No.

Target Background

Function
Potentially involved in the modulation of ribosomal DNA (rDNA) transcription.
Database Links

KEGG: sce:YGL146C

STRING: 4932.YGL146C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RRT6 and how was it identified?

RRT6 (YGL146c) is a novel p24δ isoform protein in Saccharomyces cerevisiae that was identified through genetic and functional studies. While it shows limited sequence identity (approximately 15%) to known p24 proteins, structural analysis revealed that it possesses the characteristic properties of the p24 protein family . RRT6 functions as part of heteromeric protein complexes involved in vesicular transport between the endoplasmic reticulum (ER) and Golgi. The protein was initially identified during studies examining yeast membrane trafficking pathways and subsequently characterized through molecular cloning, sequence analysis, and functional studies .

The gene encoding RRT6 can be amplified using PCR with specific primers (5′-CGGATTCTAGAACTAGTGGATCCATGGAAAAAGCTTCCTTGAACAT-3′ and 5′-GTATGGGTAAGATGGCTGCAGCAAACCTTTCTTTTTGATATGAGATGAAG-3′), allowing for its cloning and expression in recombinant systems .

What is the expression pattern of RRT6 under different growth conditions?

RRT6 exhibits a unique expression pattern that distinguishes it from other p24 family members. It is specifically induced when yeast cells are grown on glycerol, a non-fermentable carbon source that promotes respiratory growth rather than fermentation . This growth condition-dependent expression suggests RRT6 plays a specialized role in adapting membrane trafficking pathways during respiratory metabolism.

To study this expression pattern experimentally, researchers can:

  • Culture yeast cells in media containing different carbon sources (glucose vs. glycerol)

  • Extract total protein at various time points

  • Perform Western blot analysis using epitope-tagged RRT6 (e.g., 3×myc-RRT6)

  • Quantify relative expression levels compared to housekeeping controls

This approach has demonstrated that RRT6 is significantly upregulated during respiratory growth conditions, suggesting its importance for cellular adaptation to alternative carbon metabolism .

What is the subcellular localization of RRT6?

RRT6 predominantly localizes to the Golgi apparatus within yeast cells, in contrast to some other p24 complex components that mainly localize to the ER . This differential localization provides insights into its potential functional role in specific compartments of the secretory pathway.

To determine RRT6 subcellular localization, researchers typically employ:

  • Sucrose density gradient fractionation of cell lysates

  • Immunofluorescence microscopy using epitope-tagged RRT6 (e.g., 3×myc-RRT6)

  • Co-localization studies with known organelle markers

  • Membrane association assays

The membrane association of RRT6 can be experimentally determined by treating cell lysates with various extraction conditions (0.5M NaCl, 0.1M Na₂CO₃ at pH 11, or 1% Triton X-100) followed by ultracentrifugation at 100,000×g and Western blot analysis of supernatant and pellet fractions .

What protein complexes does RRT6 form?

RRT6 forms a specific αβγδ heteromeric complex with other p24 family members, specifically Erp3 (p24α), Erp5 (p24γ), and Emp24 (p24β) . This complex represents a unique combination of p24 isoforms that is induced under respiratory growth conditions.

The composition of p24 complexes can be studied using:

  • Co-immunoprecipitation with epitope-tagged proteins

  • Blue native PAGE for analysis of intact complexes

  • Crosslinking studies followed by mass spectrometry

  • Yeast two-hybrid assays for binary interactions

Research has shown that the RRT6-containing complex has unique features not found in other p24 complexes, although its precise physiological role remains to be fully determined .

How does RRT6 differ structurally from other p24 family proteins?

Despite showing limited sequence identity (approximately 15%) to known p24 proteins, RRT6 maintains the structural properties characteristic of the p24 family . This represents an interesting case of structural conservation despite sequence divergence.

The structural analysis of RRT6 involves:

  • Sequence alignment with known p24 family members

  • Identification of conserved domains (e.g., GOLD domain, coiled-coil region, transmembrane domain)

  • Secondary structure prediction

  • Molecular modeling based on solved structures of other p24 proteins

Researchers can create mutant versions of RRT6 through overlap extension PCR to investigate the functional importance of specific structural features . These mutants can then be expressed in RRT6-deletion strains to assess their ability to complement phenotypic defects.

How can RRT6 deletion strains be generated and validated?

Generation of RRT6 deletion strains is a fundamental approach to studying its function. The process typically involves:

  • PCR-based gene replacement using selectable markers (e.g., KanMX4)

  • Transformation of S. cerevisiae using lithium acetate method

  • Selection on appropriate media (e.g., G418 for KanMX4)

  • Confirmation of correct integration by PCR

  • Verification of RRT6 absence by Western blotting

Several verified RRT6 deletion strains have been created, including BY4513 (rrt6::KanMX4 in BY4741) . These strains serve as valuable tools for investigating RRT6 function through phenotypic analysis and complementation studies.

What recombinant expression systems are suitable for studying RRT6?

For recombinant expression and functional studies of RRT6, researchers can employ:

  • Yeast expression systems using centromere-based low-copy vectors

  • Epitope tagging approaches (e.g., 3×myc tag)

  • Inducible promoters for controlled expression

  • Bacterial expression systems for purification of protein domains

A documented approach involves amplifying the RRT6 (YGL146c) gene with 900-base 5′ and 600-base 3′ flanking regions by PCR and cloning into pRS316 . For epitope tagging, a BglII restriction site can be introduced after the 54th codon of the RRT6 open reading frame, allowing insertion of a 3×myc tag (pCNY611) .

What methods can be used to study the membrane association of RRT6?

As a membrane protein, characterizing RRT6's association with cellular membranes is crucial. Researchers can employ:

  • Membrane fractionation protocols

  • Extraction with various reagents to determine the nature of membrane association

  • Density gradient centrifugation

  • Protease protection assays

A specific protocol involves lysing spheroplasts in phosphate-buffered saline, adjusting the cleared lysate to either 0.5M NaCl, 0.1M Na₂CO₃ (pH 11), or 1% Triton X-100, incubating on ice for 30 minutes, and then centrifuging at 100,000×g for 1 hour . The extraction profile of RRT6 can then be assessed by Western blot analysis, providing insights into its membrane association properties.

What genetic interactions reveal the functional network of RRT6?

Genetic interaction studies provide valuable insights into the functional relationships between RRT6 and other cellular components. Research approaches include:

  • Synthetic genetic array (SGA) analysis

  • Targeted genetic crosses with specific mutants

  • Double/triple mutant phenotypic analysis

  • Suppressor screens

The RRT6 deletion strain (rrt6Δ) has been crossed with various mutants to identify potential genetic interactions, including:

  • COPI/COPII mutants (sec13-1, sec21-1, sec27-1)

  • ER/Golgi transport mutants (gcs1Δ, glo3Δ, gsg1Δ, erv14Δ, erv29Δ, svp26Δ)

  • ER-associated degradation pathway mutants (ire1Δ, hac1Δ)

These studies help place RRT6 within the broader context of cellular pathways and identify functional redundancies or synergies.

How does RRT6 contribute to protein processing and trafficking?

Recent research has revealed RRT6's involvement in protein processing, particularly in the context of signal peptide cleavage. Studies have shown that:

  • Wildtype Rrt6 undergoes cleavage in normal cells and in spc1Δ strains

  • This cleavage is completely inhibited in spc2Δ strains, lacking the Spc2 subunit of the signal peptidase complex

  • The cleavage site proximal to the h-region of RRT6 is less efficiently recognized by SPC lacking Spc2

These findings suggest that RRT6 processing is dependent on specific components of the cellular machinery, with the Spc2 subunit playing a key role in recognition of the RRT6 cleavage site .

What is the functional redundancy among p24 family members including RRT6?

The p24 protein family in S. cerevisiae shows significant functional redundancy, with RRT6 providing unique functionality under specific conditions:

  • The yeast p24 family consists of multiple isoforms across the α, β, γ, and δ subfamilies

  • These proteins form various αβγδ heteromeric complexes with overlapping functions

  • RRT6 represents a specialized p24δ isoform induced under respiratory conditions

  • The RRT6-containing complex appears to have unique features not found in other p24 complexes

Studies with multiple deletion mutants have shown that combinations of p24 deletions often result in additive or synergistic phenotypes, suggesting partial functional redundancy but also specialized roles for specific complexes .

How does experimental design affect the study of condition-specific RRT6 functions?

When designing experiments to study the respiratory condition-specific functions of RRT6, researchers should consider:

  • Carbon source selection (fermentable vs. non-fermentable)

  • Growth phase and timing of sample collection

  • Strain background effects on respiratory capacity

  • Environmental factors affecting respiratory metabolism

  • Temporal dynamics of RRT6 induction

For example, studies comparing glucose and glycerol growth conditions should account for the slower growth rate on glycerol and adjust sampling timepoints accordingly. Additionally, researchers must ensure that control strains have comparable respiratory capacity to avoid confounding variables .

What are the methodological challenges in studying p24 complex dynamics?

Studying the dynamics of p24 complexes, including those containing RRT6, presents several methodological challenges:

  • Transient nature of some protein-protein interactions

  • Difficulty preserving complex integrity during purification

  • Overlapping functions among family members

  • Presence of multiple complexes with different compositions

  • Technical limitations in resolving similar-sized membrane protein complexes

To address these challenges, researchers can employ strategies such as:

  • Crosslinking prior to extraction

  • Controlled solubilization conditions

  • Blue native PAGE or gradient gel electrophoresis

  • Mass spectrometry-based approaches for complex composition analysis

  • Live-cell imaging with fluorescently tagged proteins

How can signal peptide processing of RRT6 be experimentally analyzed?

The signal peptide processing of RRT6 represents an interesting research area at the intersection of protein biogenesis and trafficking. Experimental approaches include:

  • Site-directed mutagenesis of potential cleavage sites

  • In vitro translation and processing assays

  • Mass spectrometry to identify precise cleavage sites

  • Comparison of wildtype and mutant processing in different genetic backgrounds

Research has shown that the cleavage site proximal to the h-region of RRT6 is less efficiently recognized by the signal peptidase complex (SPC) when it lacks the Spc2 subunit . To experimentally analyze this, variants of the RRT6 signal peptide can be created by introducing substitutions to convert it into CS2-like and CS1/2-like variants, followed by assessment of their processing efficiency in wildtype and spc2Δ strains .

What statistical approaches are appropriate for analyzing RRT6 experimental data?

When analyzing experimental data related to RRT6, researchers should consider these statistical approaches:

  • For gene expression studies:

    • Normalization to reference genes

    • Log transformation of data when appropriate

    • ANOVA or t-tests for comparing expression levels

    • Multiple testing correction (e.g., Bonferroni, FDR)

  • For protein interaction studies:

    • Background subtraction and normalization

    • Appropriate controls for non-specific binding

    • Statistical significance testing for detected interactions

  • For phenotypic analyses:

    • Growth curve fitting and parameter extraction

    • Survival analysis techniques when appropriate

    • Statistical comparison of growth parameters

  • For localization studies:

    • Quantitative image analysis

    • Colocalization statistics (e.g., Pearson's correlation)

    • Appropriate controls for random distribution

When interpreting results, researchers should be cautious about confounding variables and consider the biological context of RRT6 function in respiratory growth conditions .

How should contradictory findings about RRT6 function be resolved?

When confronting contradictory findings regarding RRT6 function, researchers should systematically address potential sources of discrepancy:

  • Strain background differences:

    • Different S. cerevisiae strains may show varying phenotypes

    • Genetic background can influence RRT6-dependent processes

  • Experimental conditions:

    • Carbon source composition and concentration

    • Growth phase differences

    • Temperature variations

    • Media formulation differences

  • Methodological variations:

    • Protein extraction protocols

    • Antibody specificity

    • Assay sensitivity and dynamic range

    • Definition of phenotypic outcomes

  • Resolution approaches:

    • Direct side-by-side comparisons under identical conditions

    • Genetic complementation tests

    • Independent verification using orthogonal methods

    • Collaboration between labs reporting different results

When analyzing published data, consider that the respiratory-specific induction of RRT6 means that experiments conducted under different metabolic conditions may yield fundamentally different results regarding its function and importance .

What are promising approaches for elucidating the precise physiological role of RRT6?

Several promising research directions could help elucidate the precise physiological role of RRT6:

  • Cargo-specific trafficking assays:

    • Identification of specific cargo proteins dependent on RRT6 function

    • Tracking trafficking dynamics of respiratory metabolism-related proteins

  • Structural biology approaches:

    • Cryo-EM studies of RRT6-containing complexes

    • Structure-function analysis through targeted mutagenesis

  • Systems biology approaches:

    • Proteome-wide interaction screening

    • Metabolic flux analysis in RRT6 mutants

    • Integration of transcriptomics, proteomics, and metabolomics data

  • Comparative studies across species:

    • Functional characterization of RRT6 homologs in other fungi

    • Evolutionary analysis of respiratory metabolism adaptations

  • Advanced microscopy techniques:

    • Super-resolution imaging of RRT6 dynamics

    • Single-particle tracking of RRT6-containing vesicles

These approaches could help resolve the outstanding question of why RRT6 is specifically induced during respiratory growth and what unique functional properties its containing complex possesses .

How might RRT6 research impact broader understanding of secretory pathway adaptation?

Research on RRT6 has potential implications for broader understanding of secretory pathway adaptation:

  • Metabolic adaptation mechanisms:

    • How cells remodel trafficking pathways during metabolic shifts

    • Coordination between metabolic state and membrane trafficking

  • Specialized trafficking pathways:

    • Condition-specific deployment of trafficking machinery

    • Cargo selectivity mechanisms during cellular adaptation

  • Evolutionary aspects:

    • Conservation of adaptive trafficking mechanisms across species

    • Specialization of trafficking components for niche adaptation

  • Disease relevance:

    • Potential insights into human diseases involving secretory pathway dysfunction

    • Parallel mechanisms in higher eukaryotes during metabolic stress

Understanding how RRT6 contributes to secretory pathway adaptation during respiratory metabolism could provide a model for how cells dynamically regulate their trafficking machinery in response to changing environmental conditions .

What technological advances would facilitate more detailed study of RRT6?

Advanced technologies that could enhance RRT6 research include:

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins to identify proximal interactors

    • Temporal mapping of interaction networks during metabolic shifts

  • Advanced genome editing:

    • CRISPR-based precise editing for endogenous tagging

    • Conditional degron systems for temporal control of RRT6 function

  • In situ structural techniques:

    • Focused ion beam scanning electron microscopy (FIB-SEM)

    • Correlative light and electron microscopy (CLEM)

    • In-cell crosslinking mass spectrometry

  • Microfluidic approaches:

    • Single-cell analysis of RRT6 expression dynamics

    • Controlled environmental shifts with real-time imaging

  • Artificial intelligence applications:

    • Machine learning for image analysis and phenotype classification

    • Predictive modeling of trafficking network dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.