Recombinant Saccharomyces cerevisiae Reticulon-like protein 2 (RTN2)

Shipped with Ice Packs
In Stock

Description

General Overview

Reticulon-like protein 2 (RTN2) in Saccharomyces cerevisiae is an integral membrane protein that plays a crucial role in endoplasmic reticulum (ER) morphology and peroxisome biogenesis . Reticulons, including Rtn1, Rtn2, and Yop1, are involved in shaping the ER membrane, contributing to the formation of tubular structures due to their wedge-like structure within the membrane .

Role in Stress Response and Transcription Regulation

  • Transcription Regulation: RTN2, also known as Rtr1, is involved in regulating transcription by interacting with RNA polymerase II (RNAPII) . Disruption of RTR1 leads to sensitivity to mycophenolic acid and genetic interactions with various transcription-related genes .

  • Interaction with RNAPII Subunits: Rtr1 physically associates with active RNAPII transcriptional complexes and interacts with core RNAPII subunits like Rpb1, Rpb2, Rpb3, and Rpb8 . The protein Rtr1 shuttles between the cytoplasm and nucleus, indicating its dynamic role in transcription regulation .

  • Stress Tolerance: Rtr1 is required for growth at elevated temperatures in the presence of formamide, highlighting its role in stress tolerance .

Impact on Industrial Applications

  • Enhanced Antimicrobial Activity: Overexpression of the RER2 gene, which encodes cis-prenyltransferase in Saccharomyces cerevisiae, can enhance antimicrobial features in other organisms like Trichoderma atroviride . This is achieved by increasing the activity of secretory hydrolases and stimulating glycosylation of secretory proteins .

  • Increased Hydrolytic Enzyme Activity: Trichoderma strains with elevated cis-prenyltransferase activity exhibit higher levels of O- and N-glycosylation of secretory proteins, leading to increased hydrolytic enzyme activity and improved antimicrobial capabilities against plant pathogens .

Genetic and Biochemical Interactions

RTR1 exhibits genetic interactions with transcriptional components involved in multiple stages of transcription, including initiation and elongation . Core RNAPII subunits RPB4 and RPB9 show strong genetic interactions with rtr1Δ . Rtr1 interacts with several proteins, including the nucleolar protein Rpf2, the microtubule-associated protein Bik1, and the enzyme Ura2 .

Subcellular Localization

Rtr1 is predominantly found in the cytoplasm under normal growth conditions . Nuclear accumulation occurs upon inactivation of the Xpo1-dependent export pathway, suggesting constitutive nuclear shuttling as an important aspect of its function .

Zinc Finger Motif

Rtr1 contains a cysteine-rich motif similar to a zinc finger, which may function as an accessory DNA-binding factor for RNAPII . RPB5 and RPB9, two high-copy-number suppressors of rtr1Δ, are zinc-containing proteins located at the "jaws" of RNAPII, further suggesting a role in DNA binding .

Data Table: Genetic and Physical Interactions of RTN2/RTR1

Interaction TypeInteracting Partner(s)DescriptionCitation
Genetic InteractionRPB4, RPB9Strong genetic interactions with rtr1Δ, affecting temperature sensitivity and transcription
Physical InteractionRpb1, Rpb2, Rpb3, Rpb8Core RNAPII subunits that physically associate with Rtr1 in actively transcribing RNAPII complexes
Protein-ProteinRpf2, Bik1, Ura2Additional proteins interacting with Rtr1, suggesting diverse functional roles
ER Membrane AssociationRtn1, Yop1Reticulon family members that associate with Pex29 and Pex30 to regulate peroxisome emergence from the ER
Regulation of ERSey1Yeast orthologue of atlastin that interacts physically with Rtn1 to maintain the cortical ER meshwork
Peroxisome BiogenesisPex29, Pex30Integral membrane peroxins that reside in distinct regions of the ER and associate with Rtn1 and Yop1 to govern peroxisome emergence from the ER
Gene ExpressionRER2Overexpression enhances antimicrobial features and increases activity of secretory hydrolases in other organisms
Stress ResponseHeat shock/formamideRequired for growth at elevated temperatures in the presence of formamide, indicating a role in stress tolerance

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type during ordering for preferential development.
Synonyms
RTN2; YDL204W; D1062; Reticulon-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RTN2
Target Protein Sequence
MNRNTTTNKNANLNNSRNANAPGEAGHQNKTGLIYWTNPSKSGASFAATLVSLLILRNVN VISVLLKIGYMVLFTSFAVELSTKVLFDKGVVSRFGMQESPDLVGVLKPHIDRELDRLPA LEDRIRKLVFAHRTRNNFTIGVSLYFLHGLFAIFSMNTVLIMTTIFLYTVPLIYDRKQAR IDRAIDRMKDLVIHRFHKNYNKVVEKTEPYIDKIIPPQTDEGSYSTSISNENKSSTSQRN KSGLSSSEFDNMNDTSASKSGKDSYSTSQYNRAEYPVSQNENIGTLKSGKQEIPTEKDFN NRHENFSKPDVKTYDPRTVDIEEELAAHQRELEQNLKDGDYNLVGSKEIPDPITVPAPTR HTTKPAESQSIPIKNNETLHKTTHGLKQKLQHA
Uniprot No.

Target Background

Gene References Into Functions
  1. Investigation into the critical roles of reticulon homology domain proteins (Rtn1p, Rtn2p, and Yop1p) in brome mosaic virus RNA replication compartment formation and function. [PMID: 20805477](https://www.ncbi.nlm.nih.gov/pubmed/20805477)
Database Links

KEGG: sce:YDL204W

STRING: 4932.YDL204W

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of RTN2 in Saccharomyces cerevisiae?

RTN2 (Reticulon 2) belongs to the family of reticulon proteins that primarily localize to the endoplasmic reticulum (ER). In S. cerevisiae, RTN2 contains a reticulon homology domain (RHD) with two hydrophobic regions that form V-shaped transmembrane wedges, with both N- and C-termini facing the cytoplasm .

The protein's primary function involves inducing and maintaining ER membrane curvature. Methodologically, this has been established through:

  • Fluorescence microscopy of tagged RTN2 showing localization to ER tubules

  • Electron microscopy revealing structural changes in ER morphology when RTN2 is overexpressed or deleted

  • Functional assays demonstrating RTN2's role in ER tubulation rather than sheet formation

At the sequence level, RTN2 shares approximately 52% identity with human RTN4 in the RHD, which is less than the sequence identity shared among other mammalian reticulons (RTN1, 3, and 4, which share about 73% identity) .

How does RTN2 differ from other reticulon family members in yeast?

S. cerevisiae expresses two reticulon proteins, RTN1 and RTN2, which share functional redundancy but display distinct expression patterns and interaction profiles. To determine their functional differences, researchers typically employ:

  • Comparative gene expression analysis showing RTN2 is more responsive to ER stress

  • Yeast two-hybrid screens revealing RTN2-specific protein interactions

  • Double knockout experiments demonstrating partial functional redundancy

  • Differential subcellular fractionation showing slightly different membrane microdomain localization

The most robust method for distinguishing their functions is through phenotypic analysis of single and double deletion strains under various stress conditions, coupled with complementation experiments using chimeric proteins.

What are the optimal methods for tagging and visualizing RTN2 without disrupting its function?

When designing experiments to visualize RTN2, researchers must carefully consider tag placement to avoid disrupting the protein's membrane topology and function. Methodological recommendations include:

  • C-terminal tagging approaches:

    • Small epitope tags (HA, Myc, FLAG) are preferable to larger fluorescent proteins

    • When using fluorescent proteins, linker sequences of at least 8-10 amino acids should separate the tag from RTN2

    • Verification that tagged protein retains function through complementation assays

  • Visualization methods:

    • Live cell imaging using confocal microscopy with ER markers (e.g., HDEL-tagged proteins)

    • Super-resolution microscopy for detailed analysis of RTN2 distribution within ER tubules

    • Electron microscopy with immunogold labeling for highest resolution analysis

  • Validation approaches:

    • Fluorescence recovery after photobleaching (FRAP) to confirm normal protein dynamics

    • Co-localization studies with known ER tubule markers

    • Western blotting to verify expression levels of tagged protein compared to endogenous levels

For meaningful results, it's essential to verify that the tagged RTN2 complements the phenotypes of RTN2 deletion strains, particularly under conditions that stress the ER network .

What is the most effective approach for studying RTN2 interactions with viral replication proteins?

To investigate RTN2's interactions with viral replication proteins, several complementary approaches have proven effective:

  • Proximity labeling techniques:

    • TurboID-based proximity labeling has emerged as a powerful method for identifying proteins in close proximity to RTN2 in membrane environments

    • This approach successfully identified reticulon proteins as interaction partners of viral replication proteins in plants

  • Split-ubiquitin membrane yeast two-hybrid system:

    • Particularly useful for membrane proteins like RTN2

    • Allows detection of interactions in their native membrane environment

    • Has been used to detect interactions between plant RTNLB2 and viral proteins

  • Co-immunoprecipitation with membrane solubilization:

    • Requires careful optimization of detergents (typically 1% octylglucoside or digitonin)

    • Must include appropriate controls for nonspecific membrane protein interactions

    • Western blot confirmation of interacting partners

  • Bimolecular fluorescence complementation:

    • Split fluorescent protein fragments fused to RTN2 and potential interactors

    • Provides spatial information about where interactions occur within cells

When investigating RTN2-viral protein interactions, researchers should combine at least two independent methods to confirm interactions, as membrane protein interactions can produce false positives and negatives in single assay systems .

How does RTN2 contribute to ER membrane morphology in S. cerevisiae?

RTN2 plays a crucial role in shaping ER tubules through its ability to induce membrane curvature. The methodological approaches to study this function include:

  • Quantitative ER morphology analysis:

    • Fluorescence microscopy with ER markers (e.g., Sec63-GFP) in wild-type and RTN2-deleted strains

    • Electron microscopy to measure ER tubule diameter and distribution

    • 3D reconstruction of the ER network using confocal z-stacks

  • Membrane bending mechanisms:

    • In vitro reconstitution experiments with purified RTN2 and artificial membranes

    • Biophysical measurements of membrane curvature using GUVs (giant unilamellar vesicles)

    • Analysis of the wedge-like insertion of RTN2's hydrophobic domains into the membrane

  • Functional redundancy testing:

    • RTN1/RTN2 double deletion analysis shows more severe ER morphology defects than single deletions

    • Complementation studies with RTN homologs from other species

    • Domain swapping experiments to identify critical regions for membrane shaping

Research has shown that RTN2 specifically localizes to and stabilizes high-curvature ER membranes, and its overexpression can convert ER sheets to tubules. The C-terminal amphipathic helix appears particularly important for this function, as demonstrated in analogous studies with plant RTNLB2 .

What is the relationship between RTN2 and vesicular trafficking in yeast?

RTN2 influences vesicular trafficking through its effects on ER morphology and direct interactions with trafficking machinery. Experimental approaches to investigate this relationship include:

  • Trafficking assay methodologies:

    • Pulse-chase experiments tracking secretory cargo in RTN2 mutants

    • Quantitative analysis of trafficking rates for model cargo proteins

    • Live-cell imaging of fluorescently labeled vesicles in wild-type vs. RTN2-deleted cells

  • Interaction studies with trafficking proteins:

    • RTN2 has been shown to interact with SNARE proteins that mediate membrane fusion

    • Yeast two-hybrid screens identified interactions between reticulons and the vesicle fusion chaperone β-SNAP

    • Co-immunoprecipitation experiments confirm these interactions in native conditions

  • Connection to Rab GTPases:

    • RTN1 in yeast associates with Yip3p, a Golgi protein that binds Rab GTPases

    • Similar interactions may exist for RTN2, suggesting coordination with the Rab-regulated trafficking machinery

    • Genetic interaction screens (synthetic lethality/sickness) with RAB genes

These approaches reveal that while RTN2 primarily functions in ER morphogenesis, it has secondary functions in vesicular trafficking that may become critical under specific stress conditions or when functionally redundant proteins are absent .

How does RTN2 expression respond to different cellular stresses in yeast?

RTN2 expression is regulated in response to various cellular stresses, particularly those affecting the secretory pathway. Methodological approaches to study this regulation include:

  • Transcriptional regulation analysis:

    • Quantitative RT-PCR to measure RTN2 mRNA levels under different stress conditions

    • Reporter gene assays using the RTN2 promoter fused to luciferase or GFP

    • ChIP-seq to identify transcription factors binding to the RTN2 promoter

  • Stress induction protocols:

    • ER stress induction with tunicamycin (blocks N-glycosylation)

    • Calcium stress by calcium depletion or calcium ionophore treatment

    • Secretory pathway stress through expression of misfolded proteins

  • Signaling pathway analysis:

    • Testing RTN2 expression in mutants of stress response pathways (UPR, ERAD)

    • Pharmacological inhibition of signaling pathways to identify regulatory mechanisms

    • Genetic epistasis experiments to place RTN2 in stress response hierarchies

Research has shown that secretory pathway stress, particularly accumulation of misfolded proteins in the ER, can activate calcium signaling pathways in yeast that may influence RTN2 expression and function. This is particularly relevant when considering RTN2's potential role in pathogen interactions .

What role does RTN2 play in viral replication complex formation in yeast models?

While direct evidence for RTN2's role in viral replication in S. cerevisiae is limited, research on plant reticulons provides valuable insights that can guide yeast studies. Methodological approaches include:

  • Heterologous viral replication systems:

    • Expression of viral replication proteins in yeast to study interactions with RTN2

    • Reconstitution of minimal viral replication complexes

    • Comparison of wild-type and RTN2-deleted strains for viral replication efficiency

  • Membrane remodeling assessment:

    • Electron microscopy to visualize membrane rearrangements induced by viral proteins

    • Immunofluorescence microscopy to co-localize RTN2 with viral replication sites

    • Lipidomic analysis of membrane composition at replication sites

  • Functional domain mapping:

    • Mutation of specific RTN2 domains to identify regions critical for viral protein interactions

    • Expression of plant RTNLB2, which has been shown to interact with viral replication proteins

    • Structure-function analysis through chimeric proteins

Studies in plants have demonstrated that RTNLB2 binds to viral replication proteins, induces ER membrane curvature, and constricts ER tubules to facilitate the assembly of viral replication complexes . Similar mechanisms might operate in yeast, making RTN2 a potential target for antiviral strategies.

What are the critical domains in RTN2 responsible for its different functions?

Understanding the domain architecture of RTN2 is crucial for dissecting its multiple functions. Methodological approaches include:

  • Domain mapping techniques:

    • Systematic truncation and deletion analysis

    • Site-directed mutagenesis of conserved residues

    • Domain swapping with other reticulon family members

    • Complementation assays to test functionality of mutants

  • Key domains and their functions:

    DomainPositionFunctionExperimental Approach
    RHD (Reticulon Homology Domain)CentralER tubulationDeletion analysis, microscopy
    Hydrophobic regions (HR1, HR2)Within RHDMembrane insertionTopology mapping, membrane integration assays
    Cytosolic loopBetween HRsProtein interactionsPull-down assays, Y2H
    C-terminal amphipathic helixC-terminusMembrane curvatureMutational analysis, in vitro binding
    N-terminal regionN-terminusVariable, species-specificComparative analysis across species
  • Structure prediction and validation:

    • Advanced bioinformatic tools for membrane protein structure prediction

    • Cysteine accessibility experiments to validate topology models

    • Crosslinking studies to determine proximity relationships

Research has shown that the hydrophobic regions in the RHD form wedge-like structures in the membrane to induce curvature, while the C-terminal amphipathic helix (APH) enhances this effect. The cytosolic regions mediate protein-protein interactions that may be critical for specific functions .

How do the membrane topology models of RTN2 explain its diverse functions?

RTN2's membrane topology is complex and potentially dynamic, which may explain its multifunctional nature. Methodological approaches to study topology include:

  • Topology mapping techniques:

    • Cysteine scanning mutagenesis with membrane-impermeant labeling reagents

    • Protease protection assays to identify cytosolic vs. luminal domains

    • Glycosylation site insertion to identify luminal regions

    • Fluorescence protease protection (FPP) assays in live cells

  • Multiple topology models:

    Topology ModelKey FeaturesSupporting EvidenceFunctional Implications
    "W" modelBoth termini in cytosol, two membrane-spanning regionsCysteine accessibility, protease protectionFacilitates protein interactions in cytosol
    "V" modelSingle hairpin insertionObserved in some conditionsMay represent insertion intermediate
    Dynamic modelCondition-dependent switchingDifferent results in different systemsExplains contextual functional changes
  • Functional correlation studies:

    • Testing how topology alterations affect specific functions

    • Identifying conditions that might trigger topology changes

    • Correlating topology with interaction partners

Research on mammalian reticulons suggests that they may adopt different topologies in different membrane environments or cell types, which could enable them to perform diverse functions. Similar topology flexibility might exist for yeast RTN2, though this remains to be fully characterized .

How conserved is RTN2 function across different yeast species and other eukaryotes?

Understanding the evolutionary conservation of RTN2 provides insights into its fundamental functions. Methodological approaches include:

  • Comparative genomic analysis:

    • Sequence alignment of RTN2 homologs across species

    • Phylogenetic tree construction to trace evolutionary relationships

    • Analysis of selection pressure on different domains

  • Cross-species functional complementation:

    • Expression of RTN2 homologs from different species in S. cerevisiae rtn2Δ strains

    • Assessment of their ability to restore normal ER morphology

    • Domain swapping between homologs to identify functionally conserved regions

  • Comparative functional studies:

    • Analysis of RTN2 knockout phenotypes across species

    • Comparison of interaction partners in different organisms

    • Assessment of stress responses in different species

Research has shown that RTN2's membrane-shaping function is highly conserved, with homologs across eukaryotes capable of inducing membrane curvature. The reticulon homology domain (RHD) shows the highest conservation, while N-terminal regions are more divergent. In mammals, RTN2 shares only about 52% identity with RTN4, less than other mammalian reticulons (RTN1, 3, and 4 share ~73% identity) .

What can we learn from comparing S. cerevisiae RTN2 with plant RTNLB2?

Comparing yeast RTN2 with plant RTNLB2 provides valuable insights into both conserved and specialized functions. Methodological approaches include:

  • Structural and functional comparison:

    • Sequence alignment and structural modeling of both proteins

    • Expression of plant RTNLB2 in yeast to test for functional complementation

    • Domain swapping to identify functionally equivalent regions

  • Viral interaction comparison:

    • Assessment of yeast RTN2 interactions with viral proteins known to bind plant RTNLB2

    • Testing whether mechanisms of proviral function are conserved

    • Identification of viral proteins that interact with both RTN homologs

  • Membrane remodeling capabilities:

    • In vitro reconstitution of membrane tubulation with purified proteins

    • Quantitative comparison of membrane curvature induction

    • Analysis of oligomerization properties

Research has shown that plant RTNLB2 plays a critical role in the replication of positive-strand RNA viruses by facilitating the formation of viral replication complexes through membrane remodeling . While direct evidence for a similar role of RTN2 in yeast virus replication is limited, the conserved membrane-shaping function suggests potential parallels that could be exploited for antiviral development.

What are the optimal conditions for recombinant expression and purification of functional RTN2?

Expression and purification of membrane proteins like RTN2 present significant challenges that require specialized approaches:

  • Expression systems optimization:

    Expression SystemAdvantagesLimitationsYield Optimization Strategies
    E. coliFast growth, high yieldLacks eukaryotic modificationsUse C41/C43 strains, low temperature induction
    Yeast (P. pastoris)Native-like processingLonger growth timeMethanol induction optimization, temperature control
    Insect cellsHigher eukaryotic systemMore expensiveOptimize MOI, harvest timing
    Cell-free systemsAvoids toxicity issuesLower yieldAdd liposomes/nanodiscs during expression
  • Purification protocols:

    • Detergent screening is critical (typical starting points: DDM, LMNG, GDN)

    • Solubilization optimization (temperature, time, detergent concentration)

    • Purification in amphipols or reconstitution in nanodiscs for stability

    • Two-step purification: affinity chromatography followed by size exclusion

  • Functional verification:

    • Liposome tubulation assays to confirm membrane-shaping activity

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to assess protein stability

    • Negative stain electron microscopy to visualize protein-membrane complexes

For obtaining functionally active RTN2, maintaining the protein in a membrane-like environment throughout purification is crucial. Recent advances in membrane protein biochemistry, such as SMALP (Styrene Maleic Acid Lipid Particles) extraction, may offer advantages for RTN2 purification by keeping the protein in its native lipid environment .

How can structural studies of RTN2 inform the development of antiviral strategies?

Understanding RTN2's structure and its interactions with viral proteins could lead to novel antiviral approaches:

  • Structural determination approaches:

    • Cryo-electron microscopy of RTN2 in membrane environments

    • X-ray crystallography of soluble domains or stabilized constructs

    • NMR studies of isolated domains

    • Integrative structural biology combining multiple techniques

  • Interaction interface mapping:

    • Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces

    • Crosslinking mass spectrometry to determine proximity relationships

    • Alanine scanning mutagenesis to identify critical residues

    • Computational docking validated by experimental constraints

  • Structure-based intervention strategies:

    • Design of peptide inhibitors targeting RTN2-viral protein interfaces

    • Small molecule screening for compounds disrupting key interactions

    • Development of dominant-negative RTN2 variants that impair viral replication

    • PROTAC approach to selectively degrade RTN2 during viral infection

Research on plant RTNLB2 has demonstrated its proviral role in facilitating the formation of viral replication complexes . If similar mechanisms exist in yeast and potentially mammalian systems, structural insights into RTN2-viral protein interactions could inform the development of broad-spectrum antivirals targeting this conserved host factor rather than specific viral proteins.

What are the most promising approaches for studying RTN2's role in neurodegenerative disease models?

While S. cerevisiae lacks a nervous system, it serves as a valuable model for studying fundamental aspects of neurodegenerative diseases:

  • Yeast models of neurodegeneration:

    • Expression of disease-associated proteins (α-synuclein, Aβ, huntingtin) in yeast

    • Assessment of RTN2's impact on aggregation and toxicity

    • RTN2 overexpression or deletion in these models

  • Protein-protein interaction studies:

    • RTN2 has been shown to inhibit amyloid precursor protein processing

    • Investigation of direct interactions with neurodegeneration-associated proteins

    • Identification of shared interaction partners between RTN2 and disease proteins

  • Membrane homeostasis connection:

    • Analysis of ER stress responses in RTN2 mutants expressing neurotoxic proteins

    • Assessment of calcium homeostasis, which plays roles in both RTN2 function and neurodegeneration

    • Investigation of lipid metabolism alterations

  • Translational approaches:

    • Comparison of findings in yeast with mammalian neuronal models

    • Validation of key interactions in patient-derived samples

    • Development of high-throughput screens for modulators of RTN2 function

RTN2 mutations have been associated with hereditary spastic paraplegia , suggesting its importance in neuronal function. Understanding the fundamental cellular roles of RTN2 in yeast can provide insights into conserved mechanisms relevant to neurodegeneration.

What technologies are emerging that could advance our understanding of RTN2 dynamics and interactions?

Several cutting-edge technologies show promise for RTN2 research:

  • Advanced imaging techniques:

    • Lattice light-sheet microscopy for long-term live imaging with minimal phototoxicity

    • Correlative light and electron microscopy (CLEM) for combining dynamic and ultrastructural information

    • Super-resolution microscopy (STORM, PALM) for nanoscale visualization of RTN2 distribution

    • Single-particle tracking for analyzing RTN2 dynamics in membranes

  • Proximity-based proteomics:

    • TurboID and miniTurbo for rapid biotinylation of proximal proteins

    • APEX2 for spatially and temporally resolved proximity labeling

    • Split-TurboID for detecting specific protein-protein interactions in native contexts

    • Quantitative proximity proteomics under different conditions

  • Genome engineering approaches:

    • CRISPR-based genetic screens to identify factors affecting RTN2 function

    • Base editing for precise modification of RTN2 coding sequence

    • CRISPRi/CRISPRa for tunable modulation of RTN2 expression

    • Optogenetic control of RTN2 expression or interactions

  • Integrative multi-omics:

    • Combined transcriptomics, proteomics, and lipidomics in RTN2 mutants

    • Network analysis to place RTN2 in broader cellular pathways

    • Machine learning approaches to predict RTN2 functions from multi-omics data

These emerging technologies, particularly proximity labeling approaches that have already yielded insights into plant RTNLB2 function , hold great promise for advancing our understanding of RTN2's dynamic roles in membrane organization and protein interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.