Recombinant Saccharomyces cerevisiae Rhomboid protein 1, mitochondrial (PCP1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Biology

PCP1 regulates mitochondrial architecture through two primary mechanisms:

Proteolytic Processing of Mgm1

  • Cleaves the dynamin-like GTPase Mgm1 into short (s-Mgm1) and long (l-Mgm1) isoforms, both required for mitochondrial fusion and DNA maintenance .

  • Mutations in PCP1 (e.g., S252N, G120R) reduce Mgm1 processing efficiency, leading to fragmented mitochondria and loss of cristae ultrastructure .

Cristae Organization

  • PCP1 activity indirectly supports ATP synthase oligomerization, which stabilizes mitochondrial cristae folds .

  • Cells lacking functional PCP1 exhibit disorganized cristae and loss of respiratory competence .

Mutagenesis Studies

Random hydroxylamine mutagenesis identified critical residues for PCP1 activity:

MutantResidual ActivityMitochondrial Phenotype
G233D28.5%Severe cristae defects, mtDNA loss
S252N~50%Partial cristae disorganization
G120R~50%Moderate ATP synthase assembly defects

Applications in Protein Engineering

Recombinant PCP1 is utilized to study:

  1. Intramembrane Proteolysis Mechanisms: Substrate specificity and cleavage kinetics .

  2. Mitochondrial Disease Models: Links between protease dysfunction and mitochondrial fragmentation .

  3. Cristae Biogenesis: Role of Mgm1 processing in maintaining ATP synthase supercomplexes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PCP1; MDM37; RBD1; UGO2; YGR101W; Rhomboid protein 1, mitochondrial; Mitochondrial distribution and morphology protein 37; Processing of cytochrome c peroxidase protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
74-346
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PCP1
Target Protein Sequence
SRWKPIFNEETTNRYVRLNRFQQYQQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVP PFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSH QEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSL GASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAH LGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF
Uniprot No.

Target Background

Function
Mitochondrial rhomboid serine protease involved in processing the mitochondrial membrane fusion regulator MGM1 and the cytochrome c peroxidase (CCP1). It is essential for TIM11 stability, ATP synthase complex assembly, mitochondrial morphology, cytochrome c (CYC1) storage, and mitochondrial genome maintenance.
Gene References Into Functions
  1. Transmembrane segments of inner membrane proteins that are typically not processed by Pcp1 become cleavable when substituted for the authentic 'rhomboid cleavage region' (RCR) of Mgm1 PMID: 20558178
Database Links

KEGG: sce:YGR101W

STRING: 4932.YGR101W

Protein Families
Peptidase S54 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of PCP1 in Saccharomyces cerevisiae?

PCP1 functions as a rhomboid-type serine protease in the mitochondria of Saccharomyces cerevisiae. Its primary role involves the proteolytic processing of Mgm1, a mitochondrial dynamin-like protein. This processing is essential for maintaining proper mitochondrial morphology and ensuring the stability of mitochondrial DNA (mtDNA). The deletion of Mgm1 leads to extensive fragmentation of mitochondria and loss of mitochondrial DNA, underscoring the importance of this protein in mitochondrial dynamics .

PCP1 is homologous to Rhomboid, a serine protease known to function in intercellular signaling in Drosophila melanogaster. This evolutionary relationship suggests conservation of key structural and functional elements across species. In yeast, PCP1 specifically processes the long form of Mgm1 (l-Mgm1) into the short form (s-Mgm1), and interestingly, both isoforms are required for normal mitochondrial function .

How does the structure of PCP1 contribute to its proteolytic function?

The structure of PCP1, like other rhomboid proteases, features a compact architectural fold that is believed to induce local perturbations in the lipid bilayer. This structural arrangement facilitates substrate access prior to proteolytic cleavage . The key elements of PCP1's structure include:

  • Transmembrane domains that anchor the protein within the mitochondrial membrane

  • A catalytic dyad consisting of serine and histidine residues essential for proteolytic activity

  • Loop regions that participate in substrate recognition and binding

These structural features enable PCP1 to recognize specific substrate sequences and execute precise proteolytic cleavage while embedded within a membrane environment. The membrane-perturbing properties are particularly significant as they may facilitate the movement of substrates across or within the membrane, similar to how Der1 (a yeast paralog) induces lipid thinning to assist in the retrotranslocation of ER luminal substrates .

How can I express and purify recombinant PCP1 for in vitro studies?

Expression and purification of recombinant PCP1 presents several challenges due to its membrane-embedded nature. A methodological approach includes:

  • Vector Selection: Use a yeast expression vector containing a strong inducible promoter (e.g., GAL1) and appropriate selection markers.

  • Fusion Tags: Incorporate a C-terminal hexahistidine tag or Twin-Strep-tag for affinity purification, avoiding N-terminal tags that might interfere with mitochondrial targeting.

  • Expression Conditions:

    • Transform the construct into a protease-deficient S. cerevisiae strain

    • Grow cells in selective media containing 2% glucose until mid-log phase

    • Induce expression by transferring to media containing 2% galactose

    • Harvest cells after 8-12 hours of induction

  • Membrane Protein Extraction:

    • Disrupt cells using glass beads or enzymatic methods

    • Isolate mitochondria through differential centrifugation

    • Solubilize membranes using mild detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS

  • Purification Steps:

    • Perform affinity chromatography using Ni-NTA or Strep-Tactin resin

    • Further purify using size exclusion chromatography

    • Verify purity using SDS-PAGE and Western blotting with anti-PCP1 antibodies

This protocol should yield functionally active PCP1 suitable for biochemical and structural studies, though yields may be lower than for soluble proteins due to the challenges inherent in membrane protein purification.

What phenotypes are associated with PCP1 deletion in yeast cells?

Deletion of PCP1 in S. cerevisiae results in several distinct phenotypes that reflect its importance in mitochondrial function:

  • Mitochondrial Morphology Changes: Δpcp1 cells exhibit extensive mitochondrial fragmentation compared to the tubular network observed in wild-type cells .

  • Mitochondrial DNA Loss: Progressive loss of mitochondrial DNA occurs in Δpcp1 strains, leading to respiratory deficiency .

  • Growth Defects: Cells show impaired growth on non-fermentable carbon sources (e.g., glycerol, ethanol) that require functional mitochondria for utilization.

  • Altered Protein Processing: Incomplete processing of Mgm1, with accumulation of the long form (l-Mgm1) and absence of the short form (s-Mgm1) .

  • Membrane Potential Disruption: Reduced mitochondrial membrane potential as measured by potential-sensitive dyes like DiOC6.

These phenotypes can be partially complemented by expressing s-Mgm1 alone, but full complementation requires the presence of both Mgm1 isoforms, indicating that the processing of l-Mgm1 by PCP1 and the balance between both isoforms are crucial for maintaining normal mitochondrial structure and function .

How do mutations in conserved residues of PCP1 affect its proteolytic activity toward Mgm1?

Mutations in conserved residues of PCP1 can significantly impact its proteolytic activity toward Mgm1, with effects that vary depending on the specific residues affected:

  • Catalytic Residue Mutations: Substitutions in the catalytic serine or histidine residues (equivalent to the conserved catalytic dyad in rhomboid proteases) abolish proteolytic activity entirely, resulting in phenotypes similar to PCP1 deletion.

  • Loop Region Mutations: Similar to findings with other rhomboid pseudoproteases like Dfm1, mutations in Loop 1 of PCP1 likely impair substrate binding capabilities . These mutations might result in decreased efficiency of Mgm1 processing without completely eliminating it.

  • Transmembrane Domain Mutations: Alterations in the transmembrane regions that disrupt the membrane-perturbing properties of PCP1 can reduce its ability to access substrate, even if the catalytic site remains intact.

  • Substrate Recognition Site Mutations: Modifications to residues involved in specific recognition of Mgm1 can result in substrate discrimination defects, potentially allowing aberrant cleavage of non-target proteins or failing to recognize the proper Mgm1 cleavage site.

The functional consequences of these mutations can be assessed through:

  • Western blot analysis to monitor Mgm1 processing

  • Assessment of mitochondrial morphology using fluorescence microscopy

  • Measurement of mitochondrial respiratory function

  • Evaluation of mitochondrial DNA stability and maintenance

Understanding the impact of specific mutations provides insight into the structure-function relationship of PCP1 and helps elucidate the mechanisms underlying its proteolytic specificity.

What is the relationship between PCP1's membrane-perturbing properties and its role in protein processing?

PCP1, like other rhomboid proteases, possesses membrane-perturbing properties that appear crucial for its proteolytic function. The relationship between these properties and protein processing involves:

  • Lipid Bilayer Distortion: Similar to bacterial rhomboid proteases, PCP1 likely induces local thinning or destabilization of the lipid bilayer . This membrane perturbation may create a microenvironment that facilitates substrate access to the catalytic site.

  • Substrate Accessibility: The membrane-perturbing function potentially allows PCP1 to access cleavage sites in transmembrane or membrane-adjacent regions of Mgm1 that would otherwise be buried within the lipid bilayer and inaccessible.

  • Evolutionary Conservation: This feature appears to be conserved across rhomboid proteases and pseudoproteases. For instance, Der1, a yeast paralog involved in ER-associated degradation, has been shown to induce lipid thinning to assist in retrotranslocation of ER luminal substrates .

  • Functional Implications: The membrane-perturbing activity may explain how PCP1 can selectively cleave Mgm1 while discriminating against other membrane proteins, as the specific membrane environment around the cleavage site would need to be compatible with PCP1's membrane-perturbing mechanism.

This relationship suggests that PCP1's proteolytic activity cannot be fully understood in isolation from its membrane environment. The protein's activity depends not only on its catalytic residues but also on its ability to locally modify the membrane structure to gain access to its substrate.

How should I design experiments to study PCP1-mediated Mgm1 processing in vivo?

Designing robust experiments to study PCP1-mediated Mgm1 processing in vivo requires careful consideration of multiple factors:

  • Strain Selection and Construction:

    • Use isogenic wild-type and Δpcp1 strains to establish baseline phenotypes

    • Create strains expressing tagged versions of PCP1 and Mgm1 (e.g., with HA, FLAG, or GFP tags)

    • Develop complementation strains expressing wild-type or mutant PCP1 under control of native or inducible promoters

  • Growth Conditions:

    • Compare growth on fermentable (glucose) and non-fermentable (glycerol, ethanol) carbon sources

    • Test under different stress conditions (e.g., oxidative stress, heat shock) that might affect mitochondrial dynamics

  • Microscopy-Based Approaches:

    • Visualize mitochondrial morphology using mitochondrial-targeted fluorescent proteins

    • Employ super-resolution microscopy to analyze detailed changes in mitochondrial structure

    • Use time-lapse imaging to track dynamic changes in mitochondrial fusion and fission events

  • Biochemical Analyses:

    • Monitor Mgm1 processing through Western blotting to detect both l-Mgm1 and s-Mgm1 isoforms

    • Perform co-immunoprecipitation to identify PCP1-interacting proteins

    • Utilize pulse-chase experiments to determine the kinetics of Mgm1 processing

  • Functional Assays:

    • Measure mitochondrial respiratory capacity using oxygen consumption rate

    • Assess mitochondrial membrane potential with fluorescent dyes (e.g., TMRM, JC-1)

    • Quantify mitochondrial DNA stability through qPCR comparing mitochondrial to nuclear DNA ratios

  • Controls and Validation:

    • Include proper controls in all experiments (positive, negative, and loading controls)

    • Validate key findings using multiple, independent methodologies

    • Consider using CRISPR/Cas9 for precise genome editing to create specific mutations

The research design should follow the principles outlined in academic research design guidelines, ensuring that the evidence obtained addresses the research problem unambiguously and that appropriate controls are in place .

What techniques can be used to characterize the membrane-perturbing properties of PCP1?

Characterizing the membrane-perturbing properties of PCP1 requires specialized techniques that can detect and quantify changes in membrane structure and dynamics:

  • Fluorescence-Based Membrane Assays:

    • Laurdan fluorescence spectroscopy to measure membrane packing and fluidity

    • FRET (Förster Resonance Energy Transfer) with lipid-conjugated fluorophores to detect changes in membrane thickness

    • Environment-sensitive probes (e.g., DPH, TMA-DPH) to monitor local alterations in membrane properties

  • Biophysical Approaches:

    • Differential scanning calorimetry to detect changes in lipid phase transitions

    • Atomic force microscopy to visualize membrane topography at nanoscale resolution

    • Small-angle X-ray scattering to measure membrane thickness and organization

  • Model Membrane Systems:

    • Reconstitute purified PCP1 into liposomes of defined lipid composition

    • Use giant unilamellar vesicles (GUVs) to visualize macroscopic membrane deformations

    • Employ supported lipid bilayers for high-resolution imaging of membrane perturbations

  • Computational Methods:

    • Molecular dynamics simulations to model PCP1-membrane interactions

    • Coarse-grained simulations to predict membrane deformations over longer time scales

    • Quantitative analysis of hydrophobic mismatch between PCP1 transmembrane domains and the lipid bilayer

  • Functional Correlation Assays:

    • Compare wild-type PCP1 with mutants designed to alter membrane interactions

    • Assess how changes in membrane composition affect PCP1 activity

    • Examine lipid preference of PCP1 using liposomes of varying compositions

These techniques can be applied in combination to build a comprehensive picture of how PCP1 interacts with and modifies the membrane environment, similar to studies conducted on other membrane-perturbing proteins like Der1 .

How can I resolve contradictory data regarding PCP1 substrate specificity?

Resolving contradictory data regarding PCP1 substrate specificity requires a systematic approach to identify sources of variability and reconcile disparate findings:

  • Experimental Condition Audit:

    • Compare growth conditions, strain backgrounds, and expression systems used in different studies

    • Standardize protein extraction and detection methods to ensure comparable results

    • Evaluate whether differences in detergent types or concentrations might affect observed specificity

  • Substrate Context Analysis:

    • Investigate whether substrate recognition depends on specific membrane composition

    • Test if post-translational modifications of either PCP1 or its substrates affect recognition

    • Examine if accessory proteins or cofactors present in some experimental setups influence specificity

  • Sequential Multi-Method Validation:

    • Apply multiple, orthogonal techniques to verify substrate relationships

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both gain-of-function and loss-of-function approaches

  • Quantitative Analysis Approaches:

    • Develop kinetic models of PCP1-substrate interactions under varying conditions

    • Apply statistical methods to determine significant differences between experimental outcomes

    • Use dose-response relationships to identify threshold effects

  • Controlled Variable Isolation:

    VariableStandardization MethodImpact Assessment
    Strain backgroundUse isogenic strainsWestern blot of Mgm1 processing
    Growth phaseHarvest at specific OD600Compare early/mid/late log phase
    Carbon sourceTest glucose vs. glycerolMeasure respiratory capacity
    TemperatureControl at 30°CTest temperature sensitivity
    pHBuffer to pH 6.5Monitor pH effect on activity
  • Direct Comparison Experiments:

    • Design experiments specifically to test contradictory findings under identical conditions

    • Include positive controls known to be bona fide substrates

    • Incorporate negative controls that share similar properties but are not processed

By systematically addressing these factors, researchers can identify whether contradictory results stem from technical variations, context-dependent effects, or reflect genuine biological complexity in PCP1 function.

What statistical approaches are most appropriate for analyzing PCP1 activity data?

Analyzing PCP1 activity data requires statistical approaches that account for biological variability while maintaining sensitivity to detect significant differences:

Following sound research design principles , the selection of statistical methods should be determined by the research question and data characteristics, not chosen to maximize significance of results.

What are the most promising future research directions for PCP1 studies?

The study of PCP1 offers several promising research directions that could significantly advance our understanding of mitochondrial dynamics and membrane protein processing:

  • Structural Biology Approaches:

    • Determining high-resolution structures of PCP1 in complex with substrates

    • Investigating conformational changes during the catalytic cycle

    • Mapping the substrate-binding pocket and specificity determinants

  • Systems Biology Integration:

    • Exploring PCP1's role in broader mitochondrial stress response networks

    • Identifying genetic interactions through synthetic genetic array analysis

    • Developing computational models of mitochondrial dynamics incorporating PCP1 function

  • Evolutionary Conservation Studies:

    • Comparing PCP1 function across fungal species with different mitochondrial dynamics

    • Investigating functional conservation between yeast PCP1 and mammalian PARL (Presenilin-associated rhomboid-like protein)

    • Exploring how rhomboid proteases evolved specialized functions while maintaining structural similarities

  • Disease Relevance:

    • Examining how PCP1 dysfunction models aspects of human mitochondrial diseases

    • Using yeast as a platform to test potential therapeutic approaches for PARL-related disorders

    • Investigating links between mitochondrial dynamics, quality control, and neurodegenerative diseases

  • Technological Innovations:

    • Developing optogenetic tools to control PCP1 activity with spatial and temporal precision

    • Creating biosensors to monitor PCP1 activity in living cells

    • Applying CRISPR-based approaches for precise manipulation of PCP1 and related genes

These research directions would build upon current knowledge of PCP1's role in mitochondrial dynamics and leverage insights from related rhomboid proteases and pseudoproteases to develop a more comprehensive understanding of this important protein family.

How can findings from PCP1 research be integrated with broader studies of mitochondrial dynamics?

Integration of PCP1 research with broader studies of mitochondrial dynamics requires multidisciplinary approaches and consideration of various interconnected processes:

  • Cross-functional Analysis:

    • Connect PCP1-mediated Mgm1 processing with other mitochondrial fusion and fission machinery

    • Investigate how PCP1 activity affects mitochondrial transport along cytoskeletal elements

    • Examine the relationship between PCP1 function and mitochondrial quality control mechanisms

  • Multi-omics Integration:

    • Combine proteomics, lipidomics, and metabolomics to create comprehensive models of how PCP1 influences mitochondrial function

    • Use transcriptomics to identify compensatory mechanisms activated in response to PCP1 dysfunction

    • Apply network analysis to position PCP1 within mitochondrial protein interaction networks

  • Temporal Dynamics Studies:

    • Track PCP1 activity throughout the cell cycle and under different metabolic states

    • Monitor real-time changes in mitochondrial morphology in response to altered PCP1 function

    • Develop mathematical models that capture the dynamics of PCP1-dependent processes

  • Cross-species Comparative Analysis:

    • Compare the role of PCP1 in S. cerevisiae with homologous proteins in other model organisms

    • Translate findings from yeast to mammalian systems, particularly focusing on PARL

    • Explore how evolutionary adaptations in PCP1 reflect different mitochondrial requirements across species

  • Interdisciplinary Collaboration Framework:

    Research FieldContribution to PCP1 UnderstandingIntegration Approach
    Cell BiologyMitochondrial morphology and dynamicsLive-cell imaging combined with PCP1 manipulation
    BiochemistryEnzymatic mechanisms and regulationIn vitro reconstitution of PCP1 activity
    GeneticsGenetic interactions and pathwaysSynthetic genetic array and suppressor screens
    BiophysicsMembrane interactions and perturbationsAdvanced microscopy and membrane models
    Systems BiologyNetwork-level effectsComputational modeling and multi-omics integration

By fostering such interdisciplinary integration, researchers can position PCP1 studies within the broader context of mitochondrial biology, revealing how this specific protease contributes to the complex and dynamic functions of mitochondria in cellular homeostasis.

What are the most critical papers for understanding PCP1 function?

The literature on PCP1 includes several seminal papers that provide foundational understanding of its function. While the search results provided contain limited specific references to PCP1, they do include related information about rhomboid proteases and pseudoproteases that share functional similarities. Based on this information and the broader scientific context, the following types of papers would be most valuable:

  • Original characterization studies that identified PCP1 as a rhomboid-type protease in yeast mitochondria and established its role in Mgm1 processing .

  • Structural and mechanistic investigations of rhomboid proteases that provide insight into how these enzymes interact with membranes and access their substrates .

  • Comparative studies examining the functional relationships between different rhomboid family members across species, particularly those establishing evolutionary conservation.

  • Systems-level analyses that position PCP1 within broader mitochondrial quality control and dynamics networks.

  • Methodological papers describing approaches for studying membrane protein function in yeast mitochondria.

The search results specifically mention that deletion of the mitochondrial dynamin-like protein Mgm1 leads to extensive fragmentation of mitochondria and loss of mitochondrial DNA, and that processing of l-Mgm1 by Pcp1 and the presence of both isoforms are crucial for wild-type mitochondrial morphology and maintenance of mitochondrial DNA .

What online databases and resources are most valuable for PCP1 research?

Researchers studying PCP1 can benefit from various specialized databases and resources:

  • Protein Databases and Analysis Tools:

    • UniProt (for comprehensive protein information and sequence analysis)

    • Protein Data Bank (PDB) (for structural information on rhomboid proteases)

    • PFAM (for protein family information and domain architecture)

    • AlphaFold Protein Structure Database (for predicted structures)

  • Yeast-Specific Resources:

    • Saccharomyces Genome Database (SGD) (comprehensive resource for S. cerevisiae)

    • CYGD (Comprehensive Yeast Genome Database)

    • Yeast GFP Fusion Localization Database (for protein localization data)

    • Yeast Metabolome Database (for metabolic pathways involving mitochondria)

  • Mitochondrial Databases:

    • MitoMiner (integrated mitochondrial proteome database)

    • MitoCarta (inventory of mammalian mitochondrial genes)

    • MitoProteome (human mitochondrial protein database)

  • Interaction and Network Resources:

    • BioGRID (for protein-protein interaction data)

    • STRING (for protein interaction networks)

    • GeneMANIA (for gene function predictions and networks)

  • Evolutionary Analysis Tools:

    • Ensembl (for comparative genomics)

    • KEGG (for metabolic and signaling pathways)

    • OrthoMCL (for ortholog group identification)

  • Experimental Resources:

    • Addgene (for plasmids and constructs)

    • Yeast Genetic Resource Center (for yeast strains)

    • BioModels Database (for computational models)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.