Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit RMP1 (RMP1)

Shipped with Ice Packs
In Stock

Description

Functional Role in RNase MRP

RNase MRP processes pre-rRNA and degrades daughter cell-specific mRNAs during cell cycle progression . RMP1 is unique to RNase MRP and does not share homology with RNase P subunits .

Core Functions of RNase MRP

  • Pre-rRNA Cleavage: Essential for maturation of rRNA in the nucleolus .

  • mRNA Degradation: Regulates cell cycle exit by degrading mRNAs in daughter cells .

  • Structural Integrity: Stabilizes the RNA component of RNase MRP and facilitates substrate binding .

Research Insights and Applications

Functional Implications

  • Essentiality: Deletion of RMP1 is lethal, highlighting its indispensable role in rRNA processing .

  • Cell Cycle Regulation: RMP1-mediated mRNA degradation ensures proper daughter cell maturation .

Comparative Analysis with RNase P

FeatureRNase MRPRNase P
RNA SubunitNME1 RNARPR1 RNA
Unique SubunitsRMP1, SNM1RPR2
Shared SubunitsPOP1, POP3, POP4, POP5, POP6, POP7, POP8, RPP1All except RPR2

RMP1’s absence in RNase P underscores its specialized role in RNase MRP functionality .

Challenges in Recombinant Production

  • Heterogeneity: RNase MRP’s RNA-protein interactions complicate in vitro reassembly .

  • Stability: Recombinant RMP1 requires careful handling to maintain activity .

Future Directions

  • Therapeutic Potential: RMP1’s role in rRNA processing may inform strategies for targeting ribosomal biogenesis in pathogens .

  • Structural Elucidation: Cryo-EM studies could resolve RMP1’s precise positioning within RNase MRP .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
RMP1; YLR145W; Ribonuclease MRP protein subunit RMP1; RNA-processing protein RMP1; RNase MRP 23.6 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RMP1
Target Protein Sequence
MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAK RLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLW EINETEFIRCGCLIKNLPRTKAKSVVNDVEELGEIIDEDIGNNVQENELVITSIPKPLTE NCKKKKKRKKKNKSAIDGIFG
Uniprot No.

Target Background

Function
Functions as a component of mitochondrial ribonuclease MRP (RNase MRP), which plays a role in mitochondrial rRNA processing.
Database Links

KEGG: sce:YLR145W

STRING: 4932.YLR145W

Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm. Nucleus.

Q&A

What is the structural organization of RMP1 in Saccharomyces cerevisiae?

RMP1 in S. cerevisiae presents a distinctive structural arrangement consisting of four N-terminal alpha-helices (αI–αIV) comprising amino acids 5-123. These helices form a crucial framework for the protein's function as revealed by recent structural analysis. The protein contains functionally significant loops between these helices, particularly Loop I-II (connecting αI and αII) and Loop III-IV (connecting αIII and αIV), which are critical elements for substrate recognition . Although RMP1 shares minimal sequence homology with its human counterpart RPP64, several conserved amino acids exhibit similar positions and orientations across species, highlighting evolutionarily preserved functional domains .

How does RMP1 differ functionally from protein components shared between RNase MRP and RNase P?

Unlike shared protein components such as Pop1p, Pop4p, Pop5p, Pop6p, Pop7p, Pop8p, and Rpp1p that participate in both RNase MRP and RNase P functions, RMP1 is exclusively specific to RNase MRP . This specificity is reflected in its role in pre-rRNA processing, particularly at the ITS1 site 2, without affecting RNase P's function in pre-tRNA processing . The functional specialization of RMP1 contrasts with shared components like Pop4p, which interacts with multiple protein subunits in both complexes. This distinctive role makes RMP1 particularly valuable for understanding the unique catalytic activities of RNase MRP compared to RNase P .

What evidence supports RMP1's role in substrate recognition?

The involvement of RMP1 in substrate recognition is supported by several key findings. Structurally, the loops connecting alpha-helices αI-αII and αIII-αIV in RMP1 coordinate with residues from Pop1 and Pop4 to interact with the ITS1 substrate backbone phosphates of C2 and A3 . This coordination enables a critical flipped state of the substrate nucleotide C4. Specifically, Arg24 and Gln28 in loop I-II and Gln97 in loop III-IV of RMP1 are crucial for maintaining this flipped nucleotide configuration, which is essential for proper substrate positioning and cleavage . Additionally, comparative structural analysis with human RPP64 reveals that despite sequence divergence, the highest conservation occurs precisely in these substrate recognition regions, underscoring their functional importance across species .

What are the optimal expression systems for producing recombinant RMP1 protein?

For recombinant RMP1 production, a tailored approach using S. cerevisiae expression systems typically yields the most functionally relevant protein. When designing an expression construct, consider incorporating an N-terminal purification tag (such as His6 or GST) with a TEV protease cleavage site to facilitate both purification and optional tag removal. Expression under the control of a galactose-inducible promoter (such as GAL1) in protease-deficient yeast strains (e.g., BJ5464) optimizes yield while maintaining native folding patterns crucial for functional studies.

For experimental protocols, cultures should be grown to mid-log phase (OD600 ~0.6-0.8) before induction with 2% galactose for 8-10 hours at 30°C. Protein extraction requires careful cell lysis using either mechanical disruption or enzymatic methods with zymolyase followed by affinity chromatography. To preserve RMP1's native conformation, purification buffers should contain 20mM HEPES pH 7.4, 150mM NaCl, 1mM DTT, and 10% glycerol. This approach typically yields 2-3mg of purified protein per liter of culture, sufficient for most structural and functional analyses.

What are the key considerations for designing RMP1 interaction studies with other RNase MRP components?

Designing robust interaction studies for RMP1 requires careful consideration of several factors. Based on established research, a multi-method approach is recommended:

  • For directed yeast two-hybrid assays, construct bait plasmids containing the complete RMP1 ORF fused to the Gal4 DNA-binding domain, and test against prey constructs containing other RNase MRP protein components (particularly Pop1p and Pop4p) fused to the Gal4 activation domain . Include appropriate negative controls and validate positive interactions using reverse configurations.

  • For co-immunoprecipitation studies, choose epitope tags (HA, Myc, FLAG) that don't interfere with RMP1's interaction surfaces. Critical buffer components should include 20mM HEPES pH 7.4, 100-150mM NaCl, 0.1% NP-40, 1mM DTT, and protease inhibitors to preserve native interactions while minimizing non-specific binding.

  • For analyzing RNA-protein interactions, employ three-hybrid systems or RNA immunoprecipitation approaches to examine RMP1's interaction with the RNA MRP component. When preparing RNA constructs, ensure they maintain proper secondary structure elements by including sufficient flanking sequences .

Crosslinking studies using either chemical (DSS, formaldehyde) or UV-based approaches can provide additional validation of direct interactions identified through other methods.

How can researchers effectively design mutations in RMP1 to study its substrate recognition mechanism?

To effectively study RMP1's substrate recognition mechanism through mutagenesis, researchers should employ a strategic, structure-guided approach:

A comprehensive data table documenting each mutation's impact on binding affinity (Kd), cleavage efficiency (kcat/Km), and structural integrity provides the foundation for mechanistic interpretation. The most revealing mutations typically maintain proper folding while specifically disrupting substrate recognition, indicated by reduced binding affinity without major structural perturbations.

How does the structure and function of yeast RMP1 compare to human RPP64, and what are the implications for evolutionary conservation?

Despite extremely limited sequence homology (yielding negligible alignment scores with E-value of 0.61), yeast RMP1 and human RPP64 display remarkable structural conservation that suggests functional preservation across large evolutionary distances . A detailed comparison reveals:

What methods should researchers use to identify potential RMP1 homologs in understudied organisms?

Identifying RMP1 homologs in understudied organisms presents a significant challenge due to its limited sequence conservation across species. A multi-faceted approach is recommended:

  • Structure-based homology searching: Rather than relying on sequence-based methods alone, utilize structure-prediction algorithms like AlphaFold to generate models of candidate proteins, then employ structural alignment tools (such as DALI or TM-align) to compare with known RMP1 structures . Focus particularly on the arrangement of alpha-helices and the spatial organization of the substrate recognition loops.

  • Synteny analysis: Examine genomic regions surrounding known RNase MRP components. Conservation of gene order across species often indicates functional relationships even when sequence divergence is high.

  • Functional screening protocol:

    • Clone candidate genes identified through bioinformatic approaches

    • Express recombinant proteins and test for:
      a) Association with the RNA component of RNase MRP but not RNase P
      b) Impact on pre-rRNA processing at the species-specific ITS1 site
      c) Protein-protein interactions with conserved RNase MRP components

  • Criteria for positive identification:

    • Structural similarity to known RMP1 proteins

    • Specific association with RNase MRP complex

    • Required for pre-rRNA processing but not pre-tRNA processing

    • Protein-protein interactions with other RNase MRP components

This integrated approach has successfully identified homologs even with sequence identity below 20%, as demonstrated by the identification of human RPP64 as functionally equivalent to yeast RMP1 despite minimal sequence conservation .

What experimental approaches can distinguish between RMP1's structural role in RNase MRP assembly versus its direct role in substrate recognition?

Distinguishing between RMP1's structural and substrate recognition roles requires a carefully designed experimental strategy that separates these functions:

  • Structure-function decoupling mutations:

    • Design mutations in RMP1 that specifically target substrate-binding residues (Arg24, Gln28, Gln97) without disrupting protein-protein interactions

    • In parallel, create mutations affecting protein-protein interfaces with Pop1p/Pop4p without altering substrate-binding regions

    • Validate structural integrity of all mutants using circular dichroism and thermal shift assays

  • Stepwise reconstitution assays:

    • Establish an in vitro reconstitution system for RNase MRP using purified components

    • Assemble complexes with wild-type or mutant RMP1, or omit RMP1 entirely

    • Analyze complex formation using native gel electrophoresis, size exclusion chromatography, and electron microscopy

    • Test activity of each complex variant against pre-rRNA substrates

  • Crosslinking-mass spectrometry (XL-MS) analysis:

    • Perform crosslinking of reconstituted complexes with and without substrate

    • Identify crosslinks between RMP1 and other proteins versus RMP1 and RNA substrate

    • Map interaction networks in the presence/absence of substrate

A critical experimental outcome would be the identification of RMP1 variants that allow complex assembly (structural role intact) but impair substrate processing (recognition role compromised). This approach can dissect RMP1's dual functions and determine whether they can be separated or are inherently coupled.

How does RMP1 contribute to the specificity of RNase MRP compared to RNase P despite their shared components?

RMP1's contribution to RNase MRP specificity appears to function through multiple integrated mechanisms:

  • Direct substrate contacts: RMP1 forms specific interactions with the pre-rRNA substrate, particularly through loops I-II and III-IV, which coordinate the flipped nucleotide C4 in the substrate . These contacts are absent in RNase P, which lacks RMP1.

  • Allosteric modulation: RMP1 likely induces conformational changes in shared components (particularly Pop1 and Pop4) that alter their interaction with substrates. This hypothesis is supported by the observation that RMP1 interacts directly with several shared protein components .

  • RNA component positioning: RMP1 may help position the RNA component of RNase MRP in a specific conformation that favors pre-rRNA binding over pre-tRNA binding. This is evidenced by the specific association of RMP1 with the RNA MRP but not RNA H1 component .

Experimental evidence supporting RMP1's role in specificity includes:

  • Knockouts of RMP1 homologs specifically impair pre-rRNA processing without affecting pre-tRNA processing

  • RMP1 efficiently associates with RNA MRP but not with RNase P-specific RNA H1

  • The regions of highest conservation between yeast RMP1 and human RPP64 correspond precisely to substrate recognition domains

Together, these findings suggest that RMP1 serves as a critical specificity factor that directs the otherwise similar RNase MRP and RNase P complexes toward different substrate classes.

What are the most effective methods for studying RMP1's role in the dynamic assembly of the RNase MRP complex?

To effectively study RMP1's role in RNase MRP complex assembly dynamics, researchers should employ a complementary suite of techniques that capture different aspects of the assembly process:

  • Single-molecule fluorescence resonance energy transfer (smFRET):

    • Label RMP1 and other key components (RNA MRP, Pop1p, Pop4p) with appropriate FRET pairs

    • Monitor real-time assembly events and conformational changes

    • Quantify assembly rates, intermediate states, and the effect of substrate addition

    • This approach provides temporal resolution to distinguish assembly pathways

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Compare deuterium incorporation patterns of individual proteins, sub-complexes, and fully assembled RNase MRP

    • Identify regions of RMP1 that become protected upon complex formation

    • Map the interaction network and conformational changes during assembly

    • This method reveals structural dynamics without requiring protein modifications

  • Time-resolved cryo-electron microscopy:

    • Capture assembly intermediates by initiating assembly and vitrifying samples at defined time points

    • Reconstruct 3D structures of assembly intermediates

    • Determine the temporal sequence of component addition and conformational changes

    • This visualization approach provides structural snapshots of the assembly process

  • Quantitative assembly assays:

    • Develop a fluorescence polarization or thermophoresis-based assay to measure binding kinetics

    • Determine the order of assembly by systematic addition/omission of components

    • Measure the effect of mutations in RMP1 on assembly rates and stability

    • This quantitative approach provides binding constants and energetics of assembly

The most informative experimental design combines these approaches to create an integrated view of RMP1's role in both the thermodynamics and kinetics of RNase MRP assembly.

How should researchers interpret apparently contradictory data regarding RMP1 interactions with other RNase MRP components?

When faced with contradictory interaction data for RMP1, researchers should implement a systematic analytical framework:

  • Method-dependent discrepancies analysis:
    Different interaction detection techniques have inherent biases and limitations. Create a comparative matrix:

    Interaction MethodStrengthsLimitationsImpact on RMP1 Data
    Yeast two-hybridDetects direct binary interactionsMay miss interactions requiring cofactorsCould underestimate RMP1's interaction network
    Co-immunoprecipitationPreserves native complexesCannot distinguish direct vs. indirect interactionsMay overestimate direct RMP1 interactions
    Crosslinking-MSMaps interaction interfacesDependent on reactive residue proximityBiased toward lysine-rich interfaces
    Three-hybrid assaysDetects RNA-dependent interactionsArtificial tethering may force interactionsCould create false positives with RNA MRP
  • Condition-dependent interaction assessment:
    Systematically evaluate how experimental conditions affect reported interactions:

    • Buffer salt concentration (100mM vs. 300mM)

    • Detergent presence/absence and type

    • Reducing vs. non-reducing conditions

    • Full-length vs. truncated protein constructs

  • Biological context reconciliation:
    Consider whether contradictions reflect genuine biological complexity:

    • Assembly-dependent interactions that occur only in specific intermediate states

    • Post-translational modifications affecting interaction strength

    • Conformational changes induced by substrate binding

  • Resolution strategy:

    • Prioritize data from complementary approaches showing consistent results

    • Design experiments specifically targeting contradictory interactions

    • Consider developing native mass spectrometry approaches to determine stoichiometry and composition of subcomplexes

When interpreting specifically contradictory yeast two-hybrid data regarding RMP1's interactions, consider that interaction strength is influenced by fusion orientation and may not capture interactions requiring the RNA component . Triangulating data from multiple methods provides the most reliable interaction map.

What are common pitfalls in purifying recombinant RMP1, and how can researchers overcome them?

Researchers working with recombinant RMP1 frequently encounter several critical challenges that can compromise experimental outcomes. These issues and their solutions include:

  • Insolubility and aggregation issues:

    • Problem: RMP1 often forms inclusion bodies or aggregates during expression

    • Solution: Optimize expression conditions by lowering temperature (16-20°C), reducing inducer concentration, and using specialized strains like Rosetta or ArcticExpress

    • Alternative approach: Express RMP1 as a fusion with solubility-enhancing tags such as MBP or SUMO, followed by tag removal using specific proteases

  • Proteolytic degradation:

    • Problem: RMP1 shows susceptibility to proteolysis, particularly in the loop regions

    • Solution: Add protease inhibitor cocktails immediately after cell lysis, minimize processing time, and maintain samples at 4°C throughout purification

    • Monitoring method: Regularly analyze samples via SDS-PAGE during purification to detect degradation products

  • Co-purification of interacting partners:

    • Problem: Native interacting proteins (Pop1p, Pop4p) often co-purify with RMP1 when expressed in yeast

    • Solution: Include stringent washing steps with buffers containing 300-500mM NaCl and 0.1% Triton X-100, followed by size exclusion chromatography

    • Validation method: Mass spectrometry analysis of final preparation to confirm purity

  • Proper folding verification:

    • Problem: Recombinant RMP1 may appear pure but adopt non-native conformations

    • Solution: Implement folding validation using circular dichroism to confirm alpha-helical content, and thermal shift assays to assess stability

    • Functional test: Verify activity through in vitro reconstitution with other RNase MRP components

A recommended purification protocol incorporates affinity chromatography under gentle conditions, followed by ion exchange chromatography to remove contaminants, and finally size exclusion chromatography to ensure homogeneity. For optimal stability, store purified RMP1 in buffer containing 20mM HEPES pH 7.4, 150mM NaCl, 1mM DTT, and 10% glycerol at -80°C in small aliquots to avoid freeze-thaw cycles.

How can researchers effectively troubleshoot unsuccessful attempts to reconstitute active RNase MRP complexes containing RMP1?

Unsuccessful reconstitution of active RNase MRP complexes containing RMP1 requires systematic troubleshooting across multiple parameters:

  • Component quality assessment:

    • Verify RNA MRP integrity using denaturing gel electrophoresis and thermal denaturation profiles

    • Confirm proper folding of RMP1 and other protein components using circular dichroism

    • Assess batch-to-batch variation through activity assays of individual components

  • Assembly conditions optimization matrix:

    ParameterTest RangeMonitoring Method
    Buffer pH6.8-8.0Native gel mobility shift
    Monovalent ions50-200mM KCl/NaClActivity assays
    Divalent ions1-10mM MgCl₂Complex stability measurement
    Assembly temperature4°C, 25°C, 37°CTime-course assembly
    Assembly orderRNA first vs. protein firstComponent retention analysis
  • Substrate-assisted assembly approach:

    • Include pre-rRNA substrate during assembly

    • Test substrate fragments of varying lengths

    • Monitor assembly efficiency through substrate binding/cleavage

  • Validation experiments:

    • Use electron microscopy to visualize assembled complexes

    • Employ analytical ultracentrifugation to determine complex stoichiometry

    • Conduct limited proteolysis to assess proper complex formation

  • Functional activity rescue strategies:

    • Try adding cellular extracts to supply potentially missing cofactors

    • Test assembly in different buffer systems mimicking cellular compartments

    • Consider post-translational modifications that might be required

For RNase MRP specifically, successful reconstitution often requires a stepwise approach: first forming stable sub-complexes (e.g., RNA MRP + Pop1p + Pop4p) before adding additional components like RMP1. Monitoring each assembly step through gel shift assays provides crucial information about where the reconstitution process fails.

What are the most promising approaches for studying the role of RMP1 in disease-related contexts?

Several strategic approaches hold particular promise for investigating RMP1's role in disease contexts:

  • CRISPR-based disease modeling:

    • Generate point mutations in RPP64 (human RMP1 homolog) that mimic naturally occurring disease variants

    • Create isogenic cell lines with these mutations using CRISPR-Cas9 genome editing

    • Analyze pre-rRNA processing defects, ribosome biogenesis, and cellular phenotypes

    • This approach allows precise correlation between specific mutations and disease mechanisms

  • Patient-derived cellular models:

    • Obtain fibroblasts or induced pluripotent stem cells from patients with RNase MRP-related disorders

    • Perform rescue experiments with wild-type versus mutant RPP64

    • Conduct comparative proteomics to identify dysregulated pathways

    • This method provides direct insights into disease pathophysiology

  • Tissue-specific effects analysis:

    • Develop tissue-specific RPP64/RMP1 conditional knockout models

    • Characterize differential effects across tissues, particularly those affected in RNase MRP-related disorders

    • Identify tissue-specific protein interactions or substrates

    • This approach explains why mutations in ubiquitous components cause tissue-specific phenotypes

  • Pre-rRNA substrate specificity exploration:

    • Determine whether disease-associated mutations alter substrate recognition specificity

    • Identify potential aberrant substrates processed in disease contexts

    • Map the consequences of altered substrate processing on cellular homeostasis

    • This strategy connects molecular mechanism to disease manifestation

The integration of these approaches with advanced technologies like spatial transcriptomics and single-cell analysis of ribosome biogenesis would provide unprecedented insights into how RMP1/RPP64 dysfunction contributes to human disease.

What novel technologies and methodologies could advance our understanding of RMP1's structural dynamics during substrate recognition?

Emerging technologies offer exciting opportunities to gain deeper insights into RMP1's structural dynamics during substrate recognition:

  • Time-resolved cryo-electron microscopy:

    • Capture multiple conformational states by vitrifying samples at various time points after substrate addition

    • Reconstruct the structural trajectory of substrate recognition

    • Visualize conformational changes in RMP1 and surrounding components

    • This approach provides direct visualization of the recognition process

  • Single-molecule FRET with alternating laser excitation (smFRET-ALEX):

    • Label RMP1 and substrate RNA with appropriate fluorophores

    • Monitor real-time conformational changes during substrate engagement

    • Quantify binding kinetics, conformational dynamics, and potential intermediate states

    • This method offers sub-millisecond temporal resolution of recognition events

  • Hydrogen-deuterium exchange mass spectrometry with millisecond quench flow:

    • Compare hydrogen-deuterium exchange patterns before and after substrate binding

    • Identify regions of RMP1 that undergo folding/unfolding during recognition

    • Map the dynamic accessibility changes throughout the substrate recognition process

    • This technique provides peptide-level resolution of structural dynamics

  • Molecular dynamics simulations with enhanced sampling:

    • Integrate experimental structures into simulation frameworks

    • Apply advanced sampling techniques to overcome energy barriers

    • Model the complete substrate recognition pathway

    • Calculate energetic contributions of individual residues to recognition

    • This computational approach provides atomic-level detail inaccessible to experiments

The most powerful research strategy would combine these complementary approaches to create a multi-scale model of RMP1's dynamics, from atomic-level interactions to global conformational changes during substrate recognition. This integrated view would significantly advance our understanding of how RMP1 contributes to the specificity and efficiency of RNase MRP.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.