Recombinant Saccharomyces cerevisiae Serine palmitoyltransferase 1 (LCB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LCB1; END8; TSC2; YMR296C; Serine palmitoyltransferase 1; SPT 1; SPT1; Long chain base biosynthesis protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-558
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
LCB1
Target Protein Sequence
MAHIPEVLPKSIPIPAFIVTTSSYLWYYFNLVLTQIPGGQFIVSYIKKSHHDDPYRTTVE IGLILYGIIYYLSKPQQKKSLQAQKPNLSPQEIDALIEDWEPEPLVDPSATDEQSWRVAK TPVTMEMPIQNHITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGAC GPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSL PVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDL APLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGS TGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSNNDAVQTLQKLSKSL HDSFASDDSLRSYVIVTSSPVSAVLHLQLTPAYRSRKFGYTCEQLFETMSALQKKSQTNK FIEPYEEEEKFLQSIVDHALINYNVLITRNTIVLKQETLPIVPSLKICCNAAMSPEELKN ACESVKQSILACCQESNK
Uniprot No.

Target Background

Function
Serine palmitoyltransferase 1 (LCB1) is a component of the serine palmitoyltransferase (SPT) complex. This enzyme catalyzes the crucial initial step in sphingolipid biosynthesis, specifically the condensation of serine with palmitoyl CoA to generate the long-chain base 3-ketosphinganine.
Database Links

KEGG: sce:YMR296C

STRING: 4932.YMR296C

Protein Families
Class-II pyridoxal-phosphate-dependent aminotransferase family
Subcellular Location
Cytoplasm. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Serine Palmitoyltransferase 1 (LCB1) in Saccharomyces cerevisiae?

Serine Palmitoyltransferase 1 (LCB1) is a critical component of the enzyme serine palmitoyltransferase (SPT), which catalyzes the committed step in sphingolipid synthesis in Saccharomyces cerevisiae. LCB1 encodes a predicted peptide of 558 amino acids from a single open reading frame of 1,674 nucleotides . The protein functions as part of a heterodimer with LCB2, forming the active serine palmitoyltransferase enzyme complex that is essential for long-chain base (LCB) synthesis in the sphingolipid pathway . Hydropathy profile analysis suggests that LCB1 is a hydrophobic, globular, membrane-associated protein with two potential transmembrane helices, indicating its localization to cellular membranes where sphingolipid synthesis occurs . The importance of LCB1 is underscored by the finding that yeast mutants lacking functional LCB1 (lcb1-1 mutants) have an absolute requirement for exogenous long-chain base supplementation, demonstrating that sphingolipids are crucial for yeast viability and growth .

How does LCB1 participate in the sphingolipid biosynthesis pathway?

LCB1 forms a heterodimeric complex with LCB2 to constitute the active serine palmitoyltransferase (SPT) enzyme, which catalyzes the condensation of serine with palmitoyl-CoA to form 3-ketodihydrosphingosine . This reaction represents the initial and rate-limiting step in sphingolipid biosynthesis. As a member of the alpha-oxoamine synthase family of pyridoxal 5'-phosphate (PLP)-dependent enzymes, SPT requires both LCB1 and LCB2 subunits for proper function . While LCB2 contains the lysine residue that forms the Schiff's base with the PLP cofactor, LCB1 is essential for the structural integrity and catalytic activity of the enzyme complex . Modeling studies suggest that the active site of serine palmitoyltransferase lies at the interface between LCB1 and LCB2, with residues from both subunits contributing to substrate binding and catalysis . The reaction mechanism involves PLP-dependent decarboxylation of serine followed by condensation with palmitoyl-CoA, resulting in the formation of the sphingoid backbone that serves as the foundation for all complex sphingolipids in the cell .

What is the evolutionary significance of LCB1 conservation across species?

The evolutionary conservation of LCB1 across diverse species highlights its fundamental importance in cellular physiology. Sequence analysis of the yeast LCB1 protein reveals significant homology to 5-aminolevulinic acid synthase and 2-amino-3-ketobutyrate coenzyme A ligase, both members of the alpha-oxoamine synthase family . This conservation extends to the human ortholog SPTLC1, with mutations in human SPTLC1 causing hereditary sensory neuropathy type I (HSN1), a progressive neurological disorder . The remarkable functional conservation is demonstrated by the finding that mutations in equivalent residues of yeast LCB1 and human SPTLC1 result in similar biochemical defects, specifically the reduction of serine palmitoyltransferase activity . This conservation allows researchers to use yeast as a model system to study fundamental aspects of sphingolipid metabolism relevant to human disease. Additionally, LCB1 shows homology to Escherichia coli biotin synthetase, although the biological significance of this observation remains unclear . The conservation of the catalytic domain in LCB1 across different species suggests strong evolutionary selection pressure to maintain the structural and functional integrity of this essential enzyme.

What are the optimal methods for cloning and expressing recombinant LCB1 in laboratory settings?

For effective cloning and expression of recombinant LCB1 from S. cerevisiae, researchers should implement a multi-step strategy beginning with PCR amplification of the LCB1 gene using high-fidelity DNA polymerase and primers designed with appropriate restriction sites for subsequent cloning . Genomic DNA extracted from S. cerevisiae S288c (a reference strain) serves as an excellent template for PCR amplification . After amplification, the LCB1 gene should be purified using gel extraction followed by restriction digestion with appropriate enzymes matching the vector's multiple cloning site. For expression in yeast, vectors like pBBH1 (for intracellular expression) or pBBH4 (containing the XYNSEC signal sequence for extracellular secretion) are suitable options . The linearized vector and purified LCB1 gene fragment should be ligated using T4 DNA ligase and transformed into a suitable cloning host such as E. coli DH5α for plasmid propagation and verification by colony PCR and sequencing . For expression in S. cerevisiae, yeast molecular ligation (YML) or electroporation techniques provide efficient transformation methods, with selection on appropriate auxotrophic media lacking specific nutrients corresponding to the plasmid's selection marker . When expressing LCB1, it's essential to consider that it functions as part of a heterodimer with LCB2, so co-expression strategies may be necessary for producing functionally active serine palmitoyltransferase.

How can researchers generate and characterize LCB1 mutants to study structure-function relationships?

To generate and characterize LCB1 mutants for structure-function studies, researchers should employ site-directed mutagenesis targeting conserved residues identified through multiple sequence alignments of LCB1 homologs across species . The QuikChange or overlap extension PCR methods are particularly effective for introducing specific mutations into the LCB1 gene previously cloned into an expression vector. Priority should be given to residues in the highly conserved region of LCB1 that is predicted to form part of the catalytic domain, especially those corresponding to mutations associated with hereditary sensory neuropathy type I in the human ortholog SPTLC1 . Following mutagenesis, constructs should be verified by sequencing before transformation into an lcb1-defective yeast strain for functional complementation assays . Characterization of LCB1 mutants should include measurement of serine palmitoyltransferase activity using radiometric assays with [³H]serine and palmitoyl-CoA as substrates, analysis of protein expression levels by Western blotting, assessment of protein-protein interactions with LCB2 using co-immunoprecipitation or yeast two-hybrid assays, and examination of sphingolipid profiles using mass spectrometry . Dominant-negative effects can be assessed by co-expressing wild-type and mutant LCB1 alleles and measuring the resultant serine palmitoyltransferase activity, with a 50% reduction in activity suggesting a dominant effect similar to that observed with hereditary sensory neuropathy type I mutations .

What assays are most effective for measuring serine palmitoyltransferase activity in recombinant systems?

For measuring serine palmitoyltransferase (SPT) activity in recombinant systems expressing LCB1, several complementary approaches provide comprehensive assessment of enzyme function. The gold standard is the radiometric assay using [³H]serine and palmitoyl-CoA as substrates, which directly measures the rate of 3-ketodihydrosphingosine formation through quantification of radioactivity incorporated into the product after extraction and thin-layer chromatography separation . This assay can be performed using microsomal fractions isolated from yeast cells expressing wild-type or mutant LCB1 proteins. A non-radioactive alternative involves liquid chromatography-mass spectrometry (LC-MS) to detect and quantify 3-ketodihydrosphingosine production, offering high sensitivity and specificity without the hazards associated with radioisotopes. Functional complementation assays represent another valuable approach, wherein lcb1-defective yeast strains are transformed with plasmids expressing wild-type or mutant LCB1, and growth is assessed on media lacking exogenous long-chain bases . Growth restoration indicates functional SPT activity, while failure to complement suggests impaired enzyme function. Additionally, researchers can employ a coupled spectrophotometric assay measuring the release of coenzyme A during the condensation reaction, though this method may have lower sensitivity compared to radiometric or LC-MS approaches. When characterizing mutant enzymes, kinetic parameters (Km and Vmax) should be determined for both serine and palmitoyl-CoA substrates to identify specific effects on substrate binding versus catalysis.

What is the relationship between LCB1 function and yeast sporulation?

The relationship between LCB1 function and yeast sporulation represents a fascinating connection between sphingolipid metabolism and cellular differentiation. Research has demonstrated that diploid yeast strains homozygous for lcb1 mutations fail to sporulate, providing compelling evidence that sphingolipids play an essential role in the sporulation process . This finding suggests that specific sphingolipid species or sphingolipid-dependent signaling pathways are required for the complex cellular reorganization and meiotic divisions that occur during sporulation. The precise mechanism linking LCB1 function to sporulation remains incompletely understood, but several hypotheses exist based on known sphingolipid functions. One possibility is that sphingolipids contribute to the membrane remodeling necessary for prospore membrane formation and maturation during sporulation. Alternatively, sphingolipid metabolites such as ceramide, sphingosine, or sphingosine-1-phosphate may serve as second messengers in signaling pathways that regulate gene expression during the sporulation program. Sphingolipid-rich membrane microdomains (lipid rafts) could also play roles in organizing signaling complexes or cytoskeletal elements required for proper spore formation. To investigate this relationship, researchers can employ conditional lcb1 mutants or chemical inhibitors of serine palmitoyltransferase to determine the specific stage of sporulation that requires sphingolipid synthesis. Lipidomic analyses comparing wild-type and lcb1 mutant cells during sporulation could identify specific sphingolipid species that accumulate or diminish at particular stages, providing insights into the molecular basis of this functional connection.

How can structural modeling enhance our understanding of LCB1 mutations?

Structural modeling provides powerful insights into the molecular consequences of LCB1 mutations by predicting their impact on protein folding, stability, and interactions with LCB2 and substrates. Since no crystal structure of the yeast LCB1-LCB2 complex currently exists, homology modeling based on related alpha-oxoamine synthases serves as a valuable approach . These models can be constructed using the crystal structures of 5-aminolevulinic acid synthase or 8-amino-7-oxononanoate synthase as templates, given their sequence homology to LCB1 . Through this approach, researchers can map mutations onto the predicted three-dimensional structure to visualize their proximity to functionally important regions such as the putative active site, subunit interface, or PLP-binding pocket . Advanced molecular dynamics simulations can further predict how mutations might alter protein flexibility, solvent accessibility, or electrostatic properties. For example, modeling studies have suggested that mutations in LCB1 associated with hereditary sensory neuropathy type I are located near the lysine in LCB2 that forms the Schiff's base with PLP, potentially explaining their dominant negative effect on enzyme activity . Computational docking of substrates (serine and palmitoyl-CoA) can predict how mutations might affect substrate binding or positioning relative to the PLP cofactor. Additionally, in silico mutagenesis coupled with energy calculations can estimate the impact of novel mutations on protein stability and heterodimer formation, guiding experimental design by identifying promising candidates for functional studies. As structural biology techniques advance, these models can be refined and validated against experimental data from techniques such as cryo-electron microscopy or hydrogen-deuterium exchange mass spectrometry.

How can contradictory data regarding LCB1 function be reconciled in research studies?

Reconciling contradictory data regarding LCB1 function requires a systematic approach that considers multiple potential sources of experimental variability. First, researchers should carefully evaluate whether discrepancies arise from differences in experimental systems, as results obtained in different yeast strains (laboratory vs. industrial) or with different expression systems (genomic integration vs. plasmid-based expression) may vary significantly . The stoichiometry of LCB1 and LCB2 expression is particularly crucial, as imbalanced expression could lead to inconsistent enzyme activity measurements; therefore, quantitative Western blotting or mass spectrometry should be employed to verify protein expression levels in comparative studies . Technical variations in enzyme activity assays, including differences in substrate concentrations, buffer compositions, or detection methods, can significantly impact results and should be standardized across laboratories. When analyzing dominant-negative effects of LCB1 mutations, the presence of endogenous wild-type protein might mask or attenuate phenotypes, necessitating careful genetic background selection and potentially the use of conditional expression systems . Comprehensive analysis should include multiple complementary approaches to assess LCB1 function, such as in vitro enzyme assays, growth complementation studies, and lipidomic profiling, as relying on a single readout may provide an incomplete picture . Finally, researchers should consider that apparent contradictions might reflect genuine biological complexity, such as condition-dependent functions or interactions with different protein partners, rather than experimental artifacts. When publishing, detailed methodological descriptions and raw data sharing are essential to facilitate meta-analyses that might reveal patterns explaining apparent contradictions.

What bioinformatic approaches best predict the functional impact of novel LCB1 variants?

To predict the functional impact of novel LCB1 variants, researchers should implement a multi-layered bioinformatic strategy combining evolutionary, structural, and systems biology approaches. Sequence conservation analysis across diverse species provides a fundamental assessment, as mutations in highly conserved residues typically have greater functional consequences; tools like ConSurf can quantify conservation scores based on multiple sequence alignments of LCB1 orthologs . Protein structure prediction using AlphaFold2 or RoseTTAFold can generate reliable models of LCB1, which can then be used with tools like FoldX or DUET to calculate stability changes (ΔΔG) induced by mutations. Molecular dynamics simulations provide dynamic insights by revealing how mutations might alter protein flexibility, solvent accessibility, or hydrogen bonding networks over nanosecond to microsecond timescales. Machine learning algorithms trained on existing mutation-phenotype datasets, such as PolyPhen-2 or PROVEAN, can predict pathogenicity based on multiple features including physicochemical properties, evolutionary conservation, and structural context. For mutations at the LCB1-LCB2 interface, protein-protein interaction prediction tools like HADDOCK or InterEvDock can assess potential disruption of heterodimer formation . Network-based approaches incorporating protein-protein interaction data and gene expression correlations can predict system-level effects of LCB1 mutations on sphingolipid metabolism and related cellular processes. Researchers should prioritize experimental validation of variants predicted to be most disruptive, particularly those in the highly conserved region of LCB1 corresponding to mutations linked to hereditary sensory neuropathy type I in humans .

What emerging technologies might advance LCB1 research in the coming decade?

The next decade promises transformative advances in LCB1 research through several emerging technologies across multiple scientific disciplines. Cryo-electron microscopy (cryo-EM) stands poised to revolutionize our structural understanding by enabling visualization of the complete LCB1-LCB2 heterodimer at near-atomic resolution without the need for crystallization, potentially revealing dynamic conformational changes during catalysis that have remained elusive. CRISPR-Cas9 genome editing, particularly base editing and prime editing technologies, will facilitate precise introduction of specific LCB1 mutations in various model organisms, enabling more sophisticated in vivo studies of structure-function relationships without selection markers or exogenous DNA integration. Single-cell technologies, including single-cell RNA-sequencing and single-cell proteomics, will uncover cell-to-cell variability in LCB1 expression and function, potentially revealing specialized roles in particular yeast subpopulations during stress responses or developmental transitions such as sporulation . Microfluidic systems coupled with time-lapse microscopy will enable real-time monitoring of sphingolipid metabolism in living cells through fluorescent sensors, providing unprecedented insights into the spatiotemporal dynamics of LCB1 function. Synthetic biology approaches, including reconstitution of minimal sphingolipid synthesis pathways in liposomes or nanodiscs, will define the sufficient components for LCB1-dependent activity and enable precise manipulation of the system without cellular complexity. Machine learning algorithms trained on comprehensive mutation datasets will accurately predict how novel LCB1 variants affect enzymatic function, accelerating discovery and reducing reliance on time-consuming experimental validation. Finally, multi-omics integration through advanced computational frameworks will connect LCB1 function to global cellular physiology, revealing unexpected relationships between sphingolipid metabolism and diverse cellular processes that extend beyond currently recognized functions.

How can LCB1 research contribute to understanding human sphingolipid-related disorders?

Research on yeast LCB1 provides a valuable model system for understanding human sphingolipid-related disorders through several translational pathways. The high degree of conservation between yeast LCB1 and human SPTLC1 makes yeast an excellent platform for studying mutations associated with hereditary sensory neuropathy type I (HSN1), as demonstrated by the finding that corresponding mutations in yeast LCB1 and human SPTLC1 cause similar reductions in serine palmitoyltransferase activity . This evolutionary conservation allows researchers to leverage the genetic tractability and rapid growth of yeast to perform high-throughput screens for genetic modifiers or chemical compounds that suppress the effects of disease-associated mutations, potentially identifying therapeutic targets for human disorders. Yeast models can be particularly valuable for investigating dominant-negative mutations similar to those found in HSN1, where mutant and wild-type subunits coexist, creating complex phenotypes that are difficult to study in mammalian systems . Beyond HSN1, insights from yeast LCB1 research may illuminate mechanisms underlying other sphingolipid-related conditions, including lysosomal storage disorders, neurodegenerative diseases with sphingolipid involvement, and certain dermatological conditions. The role of LCB1 in yeast sporulation suggests potential connections to germline development or cellular differentiation processes that might be relevant to human developmental disorders . Furthermore, understanding the fundamental enzymology of serine palmitoyltransferase through studies of the LCB1-LCB2 heterodimer interface can guide the rational design of small molecule modulators targeting the human enzyme for therapeutic applications . By establishing basic principles of sphingolipid metabolism in a simple eukaryotic model, LCB1 research continues to provide foundational knowledge that informs our understanding of more complex sphingolipid biology in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.