Recombinant Saccharomyces cerevisiae Solute carrier family 25 member 38 homolog (SCRG_00613)

Shipped with Ice Packs
In Stock

Description

Functional Role in Heme Biosynthesis

SCRG_00613 is a mitochondrial transmembrane protein implicated in heme production. Functional studies of its homologs reveal:

  • Human SLC25A38: Essential for erythropoiesis, facilitating glycine transport into mitochondria or exchanging glycine for 5-aminolevulinate (ALA) across the mitochondrial membrane .

  • Yeast Hem25p (SCRG_00613): Required for ALA synthesis, a precursor to heme, via glycine import or glycine-ALA exchange .

These roles highlight its evolutionary conservation and critical function in cellular metabolism.

Amplification and Stability

During adaptive evolution experiments in S. cerevisiae, gene amplification events (e.g., tandem repeats or circular DNA formation) have been observed near autonomously replicating sequence (ARS) regions . While SCRG_00613 itself was not studied here, such mechanisms may explain how recombinant genes like SCRG_00613 achieve stable expression in industrial strains.

Functional Validation

Indirect evidence from homolog studies confirms SCRG_00613’s role in glycine/ALA transport:

  • Deletion of Hem25p in yeast disrupts heme synthesis, while overexpression rescues this defect .

  • Structural modeling of human SLC25A38 supports its classification within the mitochondrial carrier family .

Challenges and Considerations

  • Storage Issues: Small volumes may become trapped in vial seals during shipping; brief centrifugation is recommended .

  • Sequence Variability: Commercial products may differ in tags or expression systems, affecting experimental outcomes .

Future Directions

Further studies could explore:

  • Structural resolution of SCRG_00613 to elucidate substrate-binding sites.

  • Engineering S. cerevisiae strains with SCRG_00613 overexpression for enhanced heme production in biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCRG_00613; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Target Names
SCRG_00613
Target Protein Sequence
MTEQATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEIDSPLQLW RGTLPSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYEN LLTGAFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCL RDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTV TAPFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKALSAGIAWGIYE ELVKRFM
Uniprot No.

Target Background

Function

Recombinant Saccharomyces cerevisiae Solute carrier family 25 member 38 homolog (SCRG_00613) is a mitochondrial glycine transporter responsible for importing glycine into the mitochondrial matrix. It plays a critical role in providing glycine for the initial enzymatic step in heme biosynthesis: the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.

Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the recommended expression system for SCRG_00613?

Based on successful approaches with other solute carrier family 25 members, Escherichia coli expression systems, particularly E. coli Rosetta-gami B(DE3) cells, are recommended for high-level expression of SCRG_00613. This bacterial expression system has demonstrated effective production of similar proteins as inclusion bodies that can be subsequently purified by centrifugation and washing . The expression vector should contain the coding sequence for SCRG_00613 under the control of an inducible promoter, which allows for controlled protein production after bacterial growth reaches optimal density. Post-purification, protein identity should be confirmed via MALDI-TOF mass spectrometry to ensure the integrity of the recombinant protein.

How should researchers design experiments to determine the substrate specificity of SCRG_00613?

The experimental design for determining substrate specificity should follow a systematic approach:

  • Reconstitute purified SCRG_00613 into liposomes following standard protocols used for mitochondrial carriers

  • Prepare a diverse panel of potential substrates, including various amino acids, carnitine, acylcarnitines, and other metabolites

  • Conduct homoexchange experiments with the same substrate inside and outside the liposomes

  • Use radiolabeled substrates (e.g., [³H] or [¹⁴C]-labeled compounds) to track transport activity

  • Include inhibition controls using established inhibitors of mitochondrial carriers (e.g., pyridoxal 5′-phosphate and HgCl₂)

  • Implement appropriate negative controls including:

    • Boiled protein before incorporation into liposomes

    • Liposomes reconstituted with material from bacterial cells lacking the SCRG_00613 coding sequence

    • Liposomes reconstituted with unrelated mitochondrial carriers

    • Pure liposomes without incorporated protein

What methodological approach should be used to confirm the mitochondrial localization of SCRG_00613?

Confirming mitochondrial localization requires a multi-method approach:

  • Subcellular fractionation: Isolate mitochondria from yeast cells expressing SCRG_00613 using differential centrifugation, followed by Western blot analysis using antibodies against SCRG_00613 and established mitochondrial marker proteins.

  • Fluorescence microscopy: Generate a SCRG_00613-GFP fusion protein and co-stain with mitochondria-specific dyes (e.g., MitoTracker) to visualize localization in live cells.

  • Immunogold electron microscopy: Use antibodies against SCRG_00613 coupled with gold particles to precisely localize the protein within mitochondrial subcompartments.

  • Protease protection assays: Treat isolated mitochondria with proteases in the presence or absence of detergents to determine the orientation and membrane topology of SCRG_00613.

This comprehensive approach provides multiple lines of evidence for mitochondrial localization and helps determine the exact submitochondrial compartment where SCRG_00613 functions .

How can researchers differentiate between uniport and exchange mechanisms for SCRG_00613 transport activity?

Distinguishing between uniport (one-way transport) and exchange (counter-exchange transport) mechanisms requires specialized transport assays:

  • For exchange activity measurement:

    • Preload liposomes with high concentrations of potential substrates (10 mM)

    • Add radiolabeled substrate at lower concentration externally (0.4 mM)

    • Monitor the uptake of radiolabeled substrate over time

    • A positive result indicates exchange of internal for external substrate

  • For uniport activity measurement:

    • Prepare liposomes without internal substrate

    • Add radiolabeled substrate externally

    • Monitor uptake over time

    • Compare rates with exchange experiments

  • Efflux experiments:

    • Preload liposomes containing SCRG_00613 with radiolabeled substrate

    • Dilute into buffer without substrate

    • Monitor efflux of radiolabeled substrate

    • Uniporters will show significant efflux, while strict exchangers will not

  • Analysis of transport kinetics:

    • Calculate the ratio of exchange rate to uniport rate

    • Similar to SLC25A29, if SCRG_00613 operates both mechanisms, exchange rates are typically 2.8-10 fold higher than uniport rates

These methodological approaches allow researchers to definitively characterize the transport mechanism of SCRG_00613 and its physiological relevance.

What experimental approaches can resolve contradictory data regarding substrate specificity of SCRG_00613?

When faced with contradictory results regarding substrate specificity, implement this systematic troubleshooting approach:

  • Standardize protein preparation:

    • Ensure consistent purification methods across experiments

    • Verify protein integrity through circular dichroism and thermal stability assays

    • Quantify protein incorporation into liposomes

  • Modify experimental conditions:

    • Test transport at different pH values (6.5-8.0)

    • Vary membrane composition of liposomes

    • Test different internal:external substrate concentration ratios

  • Cross-validation with multiple techniques:

    • Complement liposome-based assays with whole-cell transport studies in yeast

    • Perform competition assays between substrates

    • Use isothermal titration calorimetry to directly measure substrate binding

  • Genetic approaches:

    • Create point mutations in conserved residues predicted to be involved in substrate binding

    • Analyze transport properties of chimeric proteins containing domains from related carriers

    • Perform complementation studies in yeast strains lacking related transporters

  • Data analysis framework:

Experimental ApproachControls RequiredPotential PitfallsResolution Methods
Reconstituted liposomesProtein-free liposomesLeaky liposomesOptimize lipid composition
Whole-cell assaysCells lacking SCRG_00613Contribution of endogenous transportersUse transport-deficient strains
Binding assaysHeat-denatured proteinNon-specific bindingInclude competing substrates
Competition experimentsNon-transported analogsIndirect effectsUse structurally diverse competitors

This comprehensive approach addresses discrepancies by identifying experimental variables that may lead to contradictory results .

How should researchers design experiments to determine the physiological role of SCRG_00613 in S. cerevisiae metabolism?

Determining the physiological role requires a multi-faceted approach combining genetic, biochemical, and metabolomic methods:

  • Generate and characterize knockout strains:

    • Create precise gene deletions using CRISPR-Cas9 or homologous recombination

    • Analyze growth phenotypes under various nutrient conditions and stresses

    • Perform complementation studies with wild-type and mutant versions

  • Metabolomic profiling:

    • Compare metabolite levels between wild-type and knockout strains using LC-MS/MS

    • Focus on pathways involving predicted substrates

    • Perform flux analysis with isotope-labeled substrates

  • Genetic interaction screening:

    • Conduct synthetic genetic array (SGA) analysis to identify genetic interactions

    • Perform suppressor screens to identify compensatory pathways

    • Create double mutants with genes encoding related transporters

  • Physiological assays:

    • Measure oxygen consumption rates and mitochondrial membrane potential

    • Assess mitochondrial protein synthesis rates

    • Analyze amino acid pools in mitochondrial and cytosolic compartments

  • Integrated data analysis framework:

Phenotypic AspectExperimental ApproachExpected Outcome if Involved in Amino Acid Transport
Growth characteristicsGrowth curves in different mediaGrowth defects in media lacking specific amino acids
Mitochondrial functionOxygen consumption measurementReduced respiration under specific nutrient conditions
Protein synthesis35S-methionine incorporationReduced mitochondrial protein synthesis
Metabolite homeostasisTargeted metabolomicsAltered amino acid ratios between compartments
Stress responseGrowth under oxidative stressIncreased sensitivity to oxidative stress

This systematic approach provides multiple lines of evidence for the physiological role of SCRG_00613, enabling researchers to distinguish between direct functions and secondary effects .

What are the critical factors in purifying SCRG_00613 for functional studies?

Successful purification of functional SCRG_00613 requires attention to these critical factors:

  • Expression optimization:

    • Determine optimal induction conditions (temperature, inducer concentration, time)

    • Test multiple E. coli strains (BL21, Rosetta, C41/C43 for membrane proteins)

    • Consider codon optimization of the sequence for E. coli expression

  • Inclusion body processing:

    • Implement thorough washing steps to remove contaminants

    • Use mild solubilization conditions to maintain secondary structure

    • Include protease inhibitors throughout purification process

  • Protein refolding strategy:

    • Test different detergents for solubilization (Triton X-100, sarkosyl, LDAO)

    • Implement gradual dialysis to remove denaturants

    • Include stabilizing additives (glycerol, specific lipids)

  • Quality control measures:

    • Assess homogeneity by size-exclusion chromatography

    • Verify identity by mass spectrometry

    • Confirm secondary structure by circular dichroism

    • Evaluate thermal stability using differential scanning fluorimetry

  • Reconstitution optimization:

    • Test different protein-to-lipid ratios (typically 1:50 to 1:100)

    • Compare various lipid compositions to mimic mitochondrial inner membrane

    • Optimize reconstitution methods (freeze-thaw cycles, extrusion, sonication)

Applying these methodological considerations can yield approximately 40 mg of purified protein per liter of bacterial culture, sufficient for comprehensive functional characterization .

How can researchers determine the transport kinetics and substrate affinity of SCRG_00613?

Determining transport kinetics requires systematic analysis:

  • Initial rate measurements:

    • Measure transport activity at very early time points (5-30 seconds)

    • Ensure linearity of transport with respect to time

    • Use substrate concentrations spanning at least two orders of magnitude (0.01-1 mM)

  • Kinetic parameter determination:

    • Plot initial rates versus substrate concentration

    • Fit data to appropriate kinetic models (Michaelis-Menten, Hill equation)

    • Calculate Km, Vmax, and Hill coefficient values

  • Inhibition studies:

    • Test competitive inhibitors at multiple concentrations

    • Calculate Ki values using appropriate equations

    • Determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Temperature and pH dependence:

    • Measure transport rates at different temperatures (15-40°C)

    • Calculate activation energy using Arrhenius plots

    • Determine optimal pH and pH-dependent changes in substrate affinity

  • Sample kinetic data analysis for mitochondrial carriers:

ParameterMeasurement ApproachTypical Values for SLC25 FamilySignificance
KmConcentration-dependent uptake20-500 μMShould be comparable to physiological substrate concentrations
VmaxExtrapolation from kinetic plots20-200 nmol/min/mg proteinIndicates maximum transport capacity
Transport modeCompare exchange vs. uniport rates3-10 fold higher exchange ratesDetermines physiological direction of transport
Inhibitor sensitivityIC50 determinationVaries by inhibitorProvides pharmacological profile

This comprehensive kinetic analysis provides critical insights into the transport mechanism and physiological role of SCRG_00613, enabling comparison with cytosolic concentrations of potential substrates to assess physiological relevance .

What approaches should be used to study the structure-function relationship of SCRG_00613?

Investigating structure-function relationships requires an integrated approach:

  • Homology modeling and computational analysis:

    • Construct homology models based on crystallized mitochondrial carriers

    • Identify conserved motifs and potential substrate binding sites

    • Predict transmembrane domains and functional residues

    • Simulate substrate docking and transport pathway

  • Site-directed mutagenesis strategy:

    • Target conserved residues in predicted substrate binding sites

    • Create conservative and non-conservative mutations

    • Focus on charged residues likely involved in substrate recognition

    • Introduce mutations in transmembrane domains and matrix/cytosolic loops

  • Functional characterization of mutants:

    • Express and purify mutant proteins using identical conditions

    • Reconstitute into liposomes for transport assays

    • Compare kinetic parameters with wild-type protein

    • Analyze changes in substrate specificity and inhibitor sensitivity

  • Advanced structural methods:

    • Attempt crystallization trials with various detergents and conditions

    • Consider lipidic cubic phase crystallization for membrane proteins

    • Explore cryo-EM for structure determination

    • Use cross-linking mass spectrometry to identify interaction domains

  • Structure-function correlation framework:

Protein RegionPredicted FunctionExperimental ApproachExpected Outcome of Mutations
Transmembrane domainsSubstrate translocation pathwayConserved residue mutationsAltered transport kinetics
Matrix-facing loopsSubstrate bindingCharge-reversal mutationsChanged substrate specificity
Cytosolic loopsRegulatory interactionsDeletion/truncation analysisModified regulation
Signature motifsConformational changesAlanine-scanning mutagenesisImpaired transport cycle

This systematic approach links structural features to specific functional properties, providing insight into the molecular mechanism of substrate recognition and translocation by SCRG_00613 .

What statistical approaches are most appropriate for analyzing transport data for SCRG_00613?

When analyzing transport data for SCRG_00613, researchers should implement rigorous statistical methodology:

  • Experimental design considerations:

    • Perform at least three independent protein preparations

    • Conduct each transport assay in triplicate or quadruplicate

    • Include appropriate positive and negative controls in each experiment

  • Descriptive statistics:

    • Report mean values with standard deviation or standard error

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Consider data transformations if normality assumptions are violated

  • Inferential statistics:

    • Use paired t-tests for comparing transport rates under different conditions

    • Implement ANOVA with post-hoc tests for comparing multiple conditions

    • Apply non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when appropriate

  • Regression analysis for kinetic data:

    • Use non-linear regression for fitting to Michaelis-Menten equation

    • Calculate confidence intervals for Km and Vmax values

    • Consider using global fitting for complex kinetic models

  • Statistical analysis framework:

Analysis ObjectiveRecommended Statistical ApproachConsiderations and Caveats
Compare transport ratesPaired t-test or ANOVAVerify assumptions of normality
Determine kinetic parametersNon-linear regressionEnsure sufficient data points across concentration range
Compare multiple mutantsANOVA with Dunnett's post-hocUse wild-type as control condition
Analyze inhibition patternsIC50 calculation via logistic regressionInclude Hill slope parameter for cooperative binding
Time-course analysisRepeated measures ANOVAAccount for time-dependent correlation

How should researchers interpret discrepancies between in vitro transport assays and in vivo phenotypes?

Resolving discrepancies between in vitro and in vivo results requires systematic investigation:

  • Critical evaluation of in vitro system:

    • Assess whether reconstitution conditions accurately mimic the native membrane environment

    • Consider the impact of missing regulatory factors or interacting proteins

    • Evaluate potential artifacts from protein purification and reconstitution

  • Comprehensive in vivo analysis:

    • Examine phenotypes under various growth conditions and stresses

    • Implement complementation with wild-type and mutant versions

    • Consider redundancy with other transporters that may mask phenotypes

    • Analyze subcellular metabolite distributions

  • Bridging methodologies:

    • Implement transport assays in semi-intact cells or isolated mitochondria

    • Use inducible expression systems to correlate protein levels with function

    • Employ metabolic flux analysis with stable isotope labeling

  • Integrated data interpretation framework:

Observed DiscrepancyPotential ExplanationInvestigation Approach
In vitro transport but no in vivo phenotypeFunctional redundancyCreate multiple knockout strains
In vivo phenotype without in vitro transportIndirect effects or protein interactionsPerform suppressor screens and interactome analysis
Different substrate preferencePhysiological concentrations or cofactorsTest transport with physiological concentration gradients
Different kinetic parametersPost-translational modificationsAnalyze modifications and regulatory mechanisms

This methodical approach helps researchers reconcile seemingly contradictory results between simplified in vitro systems and complex in vivo environments, leading to a more complete understanding of SCRG_00613 function .

What are the most promising approaches for studying the regulation of SCRG_00613 activity?

Investigating regulatory mechanisms requires multiple complementary approaches:

  • Post-translational modification analysis:

    • Perform mass spectrometry to identify phosphorylation, acetylation, or ubiquitination

    • Create phosphomimetic and phosphodeficient mutants

    • Test activity under different metabolic conditions that may trigger modifications

  • Transcriptional regulation:

    • Analyze promoter elements using reporter constructs

    • Identify transcription factors using chromatin immunoprecipitation

    • Study expression changes under different metabolic conditions and stresses

  • Protein-protein interactions:

    • Conduct pull-down assays and co-immunoprecipitation experiments

    • Perform membrane yeast two-hybrid screening

    • Use proximity labeling approaches (BioID, APEX) in mitochondria

  • Metabolic regulation:

    • Test allosteric regulation by metabolites not transported by SCRG_00613

    • Analyze transport activity in response to changes in membrane potential

    • Investigate effects of lipid environment on transport function

  • Integrated regulatory network analysis:

Regulatory MechanismExperimental ApproachExpected Outcome if Regulated
Transcriptional controlRT-qPCR under varied conditionsChanged mRNA levels in response to specific nutrients
Post-translational modificationPhosphoproteomic analysisModified transport activity after kinase/phosphatase treatment
Protein-protein interactionsCo-immunoprecipitationIdentified regulatory partner proteins
Membrane environmentVaried lipid compositionAltered kinetics in different membrane contexts
Metabolic feedbackActivity assays with metabolitesIdentified allosteric activators or inhibitors

This comprehensive investigation of regulatory mechanisms provides insight into how SCRG_00613 activity is integrated into the broader metabolic network of S. cerevisiae .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.