Recombinant Saccharomyces cerevisiae Sorting assembly machinery 37 kDa subunit (SAM37)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
SAM37; MAS37; PET3027; TOM37; YMR060C; YM9796.13C; Sorting assembly machinery 37 kDa subunit; MAS37 protein; Mitochondrial 37 kDa outer membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SAM37
Target Protein Sequence
MVKGSVHLWGKDGKASLISVDSIALVWFIKLCTSEEAKSMVAGLQIVFSNNTDLSSDGKL PVLILDNGTKVSGYVNIVQFLHKNICTSKYEKGTDYEEDLAIVRKKDRLLEYSLLNYVDV EISRLTDYQLFLNTKNYNEYTKKLFSKLLYFPMWYNTPLQLRSQARENCEEIIGSLTLED DEEFVESKAMESASQLAQSKTFKIAHKNKIKGKQELQQVKYNLQFDNRLQSCVSNWLAAR KKLDDSVILSSDLLFLANLYVQLGLPDGNRIRSKLEQTFGSELLNSMSNKIDDFVHRPSN NLEQRDPQFREQGNVVMSLYNLACKYI
Uniprot No.

Target Background

Function

Component of the mitochondrial outer membrane sorting assembly machinery (SAM or TOB) complex. This complex is essential for the sorting of proteins with complex topologies, such as beta-barrel proteins, to the mitochondrial outer membrane following import via the TOM complex.

Gene References Into Functions
  1. Budding yeast mitochondrial outer membrane proteins (Tom70, Tom22, and Sam37), subunits of the translocase of the outer mitochondrial membrane (TOM) and sorting and assembly machinery (SAM), are crucial for efficient pre-tRNA splicing. PMID: 30228203
  2. Ab'-NAC and Sam37 are proposed components of a system that recognizes mitochondrial proteins early in synthesis, guiding them to the mitochondrial import machinery. PMID: 28109174
  3. Sam37 interacts with the Tom22 receptor domain on the mitochondrial outer membrane's cytosolic side, linking the TOM and SAM complexes. PMID: 26416958
  4. The assembly of newly imported Tom40 is initiated at the SAM complex (SAM37) through its association with Tom5. PMID: 20668160
  5. Assembly of newly synthesized Tob55 into pre-existing TOB complexes depends on Tob38 but not Mas37. PMID: 15590639
Database Links

KEGG: sce:YMR060C

STRING: 4932.YMR060C

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of SAM37 in the context of mitochondrial protein biogenesis?

SAM37 is a peripheral membrane protein component of the Sorting and Assembly Machinery (SAM) complex in the mitochondrial outer membrane. Its primary function is to serve as a coupling factor that links the TOM (Translocase of the Outer Membrane) complex to the SAM complex, forming a translocase supercomplex.

While SAM37 is not directly involved in β-barrel precursor binding, which is primarily mediated by Sam35 and Sam50, it plays a dual role in both stabilizing the SAM complex and promoting TOM-SAM coupling .

How do phenotypes of SAM37 deletion mutants differ between Saccharomyces cerevisiae and Candida albicans?

The phenotypic consequences of SAM37 deletion differ significantly between these two fungal species:

ParameterS. cerevisiae sam37ΔC. albicans sam37ΔΔ
Growth rate in YPD (doubling time)1.96 ± 0.07 h (vs. 1.89 ± 0.05 h for WT)2.5 ± 0.2 h (vs. 1.4 ± 0.03 h for WT)
Growth rate in synthetic medium3.88 ± 0.44 h (vs. 3.93 ± 0.38 h for WT)4.01 ± 0.5 h (vs. 1.98 ± 0.05 h for WT)
mtDNA stabilityNot affected76.6% ± 3.4% cells lacking mtDNA
Cell wall integrityNot significantly affectedHypersensitive to cell wall-targeting drugs
Mitochondrial morphologyNormalAggregated, clumped mitochondria
Virulence in mouse modelNot testedAvirulent

This stark contrast in phenotypes suggests that SAM37 has evolved different or additional functions in C. albicans compared to S. cerevisiae, particularly in maintaining mitochondrial DNA stability and cell wall integrity .

What experimental approaches can be used to detect and analyze SAM37 protein interactions?

Several experimental approaches can be employed to study SAM37 interactions:

  • Chemical Cross-linking: Using homobifunctional amino-reactive reagents with intact mitochondria to detect proximity between SAM37 and other proteins. For example, cross-linking experiments with bismaleimidoethane (BMOE) have been used to demonstrate the interaction between SAM37 and the cytosolic receptor domain of Tom22 .

  • Affinity Purification: Utilizing His-tagged proteins (e.g., Tom22-His) to isolate protein complexes after cross-linking and identify interaction partners through immunodecoration .

  • In Vitro Binding Assays: Using recombinantly expressed proteins to test direct binding between SAM37 and putative interaction partners.

  • Blue Native Electrophoresis: To study the assembly of β-barrel proteins and the formation of TOM-SAM supercomplexes in digitonin-solubilized mitochondria .

  • In Organello Import Assays: To assess the functional impact of SAM37 on protein import and assembly by importing radiolabeled precursor proteins into isolated mitochondria .

What is the structure of the SAM complex and how does SAM37 contribute to it?

The SAM complex consists of three main components:

  • SAM50 (core component): A β-barrel protein containing 16 β-strands spanning the outer membrane, with a POTRA (polypeptide transport-associated) domain extending into the intermembrane space. SAM50 functions as the channel for β-barrel precursor insertion .

  • SAM35: Essential protein that cooperates with SAM50 in precursor recognition through direct interaction with the β-signal of precursor proteins .

  • SAM37: Peripheral membrane protein located on the cytosolic side of the outer membrane. While not essential for viability in S. cerevisiae, it plays critical roles in SAM complex stability and function .

SAM37 contributes to the complex by:

  • Stabilizing the SAM35-SAM50 subcomplex

  • Facilitating the binding of the TOM complex through interaction with Tom22

  • Promoting both early steps (precursor transfer) and late steps (precursor maturation) of β-barrel protein biogenesis

How can recombinant SAM37 be used to restore function in SAM37-deficient mitochondria?

Recombinant SAM37 can be used to functionally complement SAM37-deficient mitochondria through the following methodological approach:

  • Production of Recombinant SAM37:

    • Synthesize SAM37 in large amounts using a cell-free translation system based on wheat germ extract .

    • Alternatively, express SAM37 in E. coli and purify it using affinity chromatography.

  • In Organello Import and Functional Restoration:

    • Import the recombinant SAM37 into purified sam37Δ mitochondria.

    • Incubate to allow incorporation into the SAM complex.

    • Verify successful import by protease protection assays or western blotting.

  • Functional Assessment:

    • Import radiolabeled β-barrel precursors (e.g., [35S]Tom40) into the complemented mitochondria.

    • Monitor assembly intermediates by blue native electrophoresis.

    • Compare with wild-type and sam37Δ mitochondria to assess restoration of function.

Research has demonstrated that in vitro-imported SAM37 can restore the binding of β-barrel precursors to the SAM complex in sam37Δ mitochondria, while control proteins (e.g., Tom5) cannot . This indicates the specificity of SAM37's function in β-barrel protein biogenesis.

What molecular mechanisms underlie SAM37's role in mitochondrial DNA stability in Candida albicans?

While the exact molecular mechanisms remain incompletely characterized, several hypotheses and supporting evidence explain SAM37's role in mtDNA stability in C. albicans:

  • Functional Interactions with Membrane-Spanning Complexes:
    SAM37 may functionally interact with complexes known to be involved in mtDNA maintenance:

    • ERMES (ER-Mitochondria Encounter Structure): Links ER and mitochondrial outer membranes

    • MICOS (Mitochondrial Contact Site) complex: Connects outer and inner mitochondrial membranes

  • Species-Specific Structural Organization:

    • The SAM complex organization appears to differ between C. albicans and S. cerevisiae

    • In C. albicans, SAM37 may have evolved additional functions related to mtDNA nucleoid anchoring or replication

  • Indirect Effects via Protein Import:

    • Impaired import of essential mtDNA maintenance factors could occur in sam37ΔΔ mutants

    • Disruption of the TOM-SAM supercomplex may affect multiple mitochondrial functions beyond β-barrel assembly

Notably, while 76.6% ± 3.4% of sam37ΔΔ cells lose mtDNA, those that retain it maintain normal mitochondrial function, as evidenced by their ability to grow on glycerol as a carbon source . This suggests SAM37 affects mtDNA stability rather than expression or function.

How can researchers resolve conflicting data on SAM37's role between Saccharomyces cerevisiae and Candida albicans?

Addressing discrepancies in SAM37 function between yeast species requires a multifaceted research approach:

  • Complementation Studies:

    • Express C. albicans SAM37 in S. cerevisiae sam37Δ mutants and vice versa

    • Assess whether cross-species expression restores species-specific functions

    • This would determine if functional differences are due to the protein itself or its cellular context

  • Domain Swap Experiments:

    • Create chimeric proteins containing domains from both species' SAM37

    • Identify which regions confer species-specific functions

    • Focus particularly on domains with lower sequence conservation

  • Interactome Analysis:

    • Compare SAM37 protein interaction networks between species using techniques like BioID, affinity purification-mass spectrometry, or yeast two-hybrid screens

    • Identify species-specific interaction partners that might explain functional differences

  • Evolutionary Analysis:

    • Conduct phylogenetic analysis of SAM37 across fungal species

    • Correlate evolutionary changes with species-specific traits such as petite-positivity/negativity

    • Identify sites under positive selection that might indicate functional adaptations

  • Structural Studies:

    • Determine if structural differences in SAM37 or the SAM complex explain functional divergence

    • Employ cryoEM or crystallography approaches for structural comparison

These approaches would help elucidate whether SAM37's differential roles reflect adaptation to different cellular environments or intrinsic differences in protein structure and function between species.

What are the biochemical methods for analyzing the role of SAM37 in TOM-SAM supercomplex formation?

Investigating SAM37's role in TOM-SAM supercomplex assembly requires sophisticated biochemical approaches:

  • Blue Native Electrophoresis (BNE):

    • Solubilize mitochondria under mild conditions using digitonin

    • Separate native protein complexes based on size

    • Detect supercomplexes using antibodies against both TOM and SAM components

    • Compare wild-type, sam37Δ, and complemented mitochondria to assess supercomplex formation

  • Quantitative Cross-linking Mass Spectrometry (QCLMS):

    • Use isotopically labeled cross-linkers to capture protein-protein interactions

    • Compare cross-linking patterns between wild-type and sam37Δ mitochondria

    • Identify specific residues involved in complex formation

    • Quantify differences in cross-linking efficiency to measure complex stability

  • Sucrose Gradient Ultracentrifugation:

    • Separate protein complexes based on size and density

    • Analyze the co-migration of TOM and SAM components

    • Compare fractionation patterns between wild-type and sam37Δ mitochondria

  • Immunoprecipitation of TOM-SAM Supercomplexes:

    • Use antibodies against TOM or SAM components to pull down associated proteins

    • Analyze the composition of isolated complexes by western blotting or mass spectrometry

    • Quantify the efficiency of co-precipitation in the presence or absence of SAM37

  • Site-Specific Cross-linking:

    • Introduce cysteine residues at specific positions in Tom22 (e.g., Cys33 and Cys66 as demonstrated in research)

    • Use cysteine-specific cross-linkers like BMOE (bismaleimidoethane) to capture interactions

    • Analyze cross-linking efficiency to identify key interaction sites

Research has demonstrated that cross-linking between Tom22 and SAM37 is significantly more efficient than between Tom22 and other SAM components, highlighting SAM37's primary role in TOM-SAM coupling .

What experimental design would best elucidate SAM37's role in cell wall integrity in fungal pathogens?

A comprehensive experimental design to investigate SAM37's relationship to cell wall integrity in fungal pathogens should include:

  • Phenotypic Characterization:

    • Assess sensitivity to cell wall stressors (Calcofluor White, Congo Red, caspofungin)

    • Measure growth under osmotic stress conditions

    • Quantify cell lysis rates under various conditions

    • Compare wild-type, sam37ΔΔ, and complemented strains

  • Cell Wall Composition Analysis:

    • Quantify β-glucan, chitin, and mannan content using specific dyes and fluorescent probes

    • Perform structural analysis using solid-state NMR or mass spectrometry

    • Compare results across multiple fungal species to identify conserved patterns

  • Signaling Pathway Analysis:

    • Monitor activation of cell wall integrity pathways (e.g., PKC pathway)

    • Measure phosphorylation of key signaling components

    • Use transcriptomics to assess global responses to cell wall stress

    • Create double mutants with components of cell wall integrity pathways

  • Proteomic Analysis of Cell Wall:

    • Use SILAC (Stable Isotope Labeling by Amino acids in Cell culture) to quantitatively compare cell wall proteomes

    • Focus particularly on GPI-anchored proteins that might be affected by alterations in phosphatidylethanolamine synthesis

  • In Vivo Models:

    • Assess virulence and tissue colonization in mouse infection models

    • Examine host immune responses to wild-type versus sam37ΔΔ mutants

    • Monitor cell wall exposure of pathogen-associated molecular patterns (PAMPs)

Research in C. albicans has already established that sam37ΔΔ mutants show hypersensitivity to cell wall-targeting drugs and altered cell wall structure, but the precise mechanisms linking mitochondrial function to cell wall integrity remain to be fully elucidated .

What approaches can be used to exploit SAM37 as a potential antifungal drug target?

Given that SAM37 is essential for virulence in C. albicans and shows significant divergence from mammalian counterparts, it represents a promising antifungal drug target. A comprehensive drug discovery strategy would include:

  • Target Validation:

    • Confirm essentiality for virulence across multiple fungal pathogens beyond C. albicans

    • Verify that conditional depletion of SAM37 in established infections leads to clearance

    • Demonstrate that SAM37 function cannot be compensated by redundant pathways

  • Structural Analysis and Virtual Screening:

    • Determine the three-dimensional structure of fungal SAM37 using X-ray crystallography or cryoEM

    • Perform in silico screening of compound libraries targeting SAM37-specific domains

    • Focus on regions showing greatest divergence from mammalian homologs

  • High-Throughput Screening Assays:

    • Develop cell-based assays measuring SAM37 function or TOM-SAM coupling

    • Design biochemical assays using recombinant proteins to measure direct binding

    • Screen compound libraries for molecules that specifically inhibit fungal SAM37

  • Lead Optimization and Medicinal Chemistry:

    • Optimize hit compounds for improved potency, selectivity, and drug-like properties

    • Focus on maintaining selectivity for fungal versus mammalian proteins

    • Address pharmacokinetic properties for effective in vivo delivery

  • Resistance Potential Analysis:

    • Assess the likelihood of resistance development using laboratory evolution

    • Identify potential compensatory mutations or pathways

    • Develop combination strategies to minimize resistance emergence

Bioinformatic analyses have already established that fungal SAM37 proteins are significantly diverged from their animal counterparts, supporting the feasibility of developing selective inhibitors . This species selectivity, combined with SAM37's essential role in virulence, makes it a particularly attractive antifungal target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.