Recombinant Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1 (RSB1)

Shipped with Ice Packs
In Stock

Description

Predicted Topology

RSB1 is a 382-residue integral membrane protein with seven transmembrane domains, resembling G-protein-coupled receptors (GPCRs) rather than classical transporters . Two N-linked glycosylation sites in its N terminus confirm plasma membrane localization .

Key Activities

  • Sphingoid Long-Chain Base (LCB) Transport: Rsb1 mediates ATP-dependent efflux of LCBs (e.g., phytosphingosine) across membranes, reducing intracellular toxicity .

  • Regulation of Endocytosis: Modulates trafficking of nutrient permeases (e.g., tryptophan transporter Tat2) by influencing their plasma membrane retention or vacuolar degradation .

  • Lipid Asymmetry Maintenance: Compensates for glycerophospholipid imbalance by interacting with ABC transporters Pdr5/Yor1 and flippases Dnf1/Dnf2 .

Gene Ontology (GO) Annotations

Biological ProcessMolecular FunctionCellular Component
Lipid translocationATP-dependent transporterPlasma membrane, integral component

Key Studies and Insights

Study FocusMajor FindingsReferences
LCB Transport MechanismRsb1 overexpression reduces intracellular LCB accumulation via ATP-dependent efflux, with specificity for sphingosine/dihydrosphingosine .
Endocytic Regulationrsb1Δ strains exhibit defective Tat2 localization, linking Rsb1 to permease trafficking rather than direct LCB export .
Genetic InteractionsRsb1 expression is induced by lipid asymmetry disruptions (e.g., pdr5Δ, yor1Δ) via the Rim101-Nrg1 signaling pathway .
Structural MutantsC-terminal truncations (e.g., Rsb1ΔC360) increase protein stability but reduce PHS resistance, implicating the C terminus in turnover regulation .

Experimental Uses

  • Lipid Transport Assays: Reconstituted in liposomes to study ATP-dependent LCB translocation .

  • Membrane Trafficking Studies: Used to dissect endocytic pathways of nutrient transporters .

  • Sphingolipid Metabolism: Investigates crosstalk between sphingolipids and glycerophospholipids in membrane asymmetry .

Therapeutic Potential

While primarily a research tool, RSB1’s role in LCB homeostasis offers insights into diseases linked to sphingolipid dysregulation, such as neuropathies and cancer .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order remarks, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for specific delivery timeframes.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend centrifuging the vial briefly to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. The default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
RSB1; SCY_5122; Sphingoid long-chain base transporter RSB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
RSB1
Target Protein Sequence
MSNATNNTLGSLLPQLEAAANSNSLYGGMVPNLRFNITMIVIWGILLTIHVVQLLMRQYW FSIAFICTGILEVLGFIGRTWSHSNVADMDAFLLNMICLTIAPVFTMGGIYYQLAKLIEV YGHRFSLLPSPMAYSFIFICSDIVSLVVQAVGGGLCGVAVTDGTSTTTGNHVFIAGLAIQ VASMAIFLMLWFHFLFRIYISVRWEHINSRPISLSLLKISQTEVDYLYREKFHFLRLEPK RWVFHYFNLAMTVAVLTIFTRCCYRLAELVVGWDGYLITHEWYFIILDALMMAIATVTLT IFHPGFAFKGRSTSIPITPRHVDPETLPHTDDVEDILDTSDSKQFDIEKEEFQASMKYPI STFKQFMSKIANLFSSKKKAKL
Uniprot No.

Target Background

Function
RSB1, a protein found in Saccharomyces cerevisiae, catalyzes the ATP-dependent translocation of sphingoid long-chain bases (LCBs) from the cytoplasm to the extracytoplasmic side of the membrane (flip-flop). This process is crucial for establishing the functional lipid asymmetry of the plasma membrane. RSB1 regulates intracellular levels of LCBs, which are sphingolipid precursors that can inhibit growth when present in elevated levels.
Protein Families
Lipid-translocating exporter (LTE) (TC 9.A.26.1) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is RSB1 and what is its basic function in Saccharomyces cerevisiae?

RSB1 (Resistance to Sphingoid long-chain Base) is a gene in Saccharomyces cerevisiae that encodes a membrane protein involved in sphingolipid metabolism. It was identified as a multicopy suppressor of the long-chain base (LCB)-sensitive phenotype in yeast mutants lacking LCB phosphate lyase . The protein functions primarily as a transporter or flippase that translocates sphingoid long-chain bases from the cytoplasmic side toward the extracytoplasmic side of the membrane in an ATP-dependent manner . This translocation activity helps maintain appropriate levels of bioactive sphingolipids within cells and provides resistance against the toxic effects of excess long-chain bases .

What is the molecular structure of the Rsb1 protein?

Rsb1p is a polypeptide consisting of 354 amino acids with a molecular mass of approximately 40.4 kDa . It is predicted to be an integral membrane protein with seven transmembrane-spanning domains, characteristic of many transporter proteins . The protein contains an ATP binding motif that is essential for its function, as mutations in this domain completely abolish its transport activity . Rsb1p is localized to both the endoplasmic reticulum and the plasma membrane, consistent with its role in sphingolipid transport across cellular membranes .

How does Rsb1p differ from other lipid transporters in yeast?

Unlike many lipid transporters that have broad substrate specificity, Rsb1p demonstrates remarkable selectivity for sphingoid long-chain bases . Substrate specificity analysis has revealed that Rsb1p is active on LCBs but shows no detectable activity on long-chain base phosphates (LCBPs) or other hydrophobic compounds . This distinguishes it from other lipid transporters such as ABC transporters, which typically handle a wider range of substrates. Furthermore, while the mechanisms for glycerophospholipid translocation have been well-studied, Rsb1p represents a specialized system for sphingolipid translocation, filling a previously uncharacterized niche in the yeast lipid transport repertoire .

What are the standard methods for measuring Rsb1p transport activity?

The standard assay for measuring Rsb1p transport activity is the [³H]DHS (tritium-labeled dihydrosphingosine) release assay . In this methodology:

  • Yeast cells are first incubated with [³H]DHS to allow incorporation into cellular membranes

  • After washing to remove unincorporated label, cells are resuspended in fresh medium containing bovine serum albumin (BSA)

  • The release of [³H]DHS into the medium is measured over time

  • The percentage of released DHS relative to total cellular DHS is calculated

Wild-type cells typically show approximately 7.5% DHS release, while Δrsb1 mutants show dramatically reduced release (approximately 0.9%) . This assay is critically dependent on the presence of BSA in the medium, which has a high affinity for lipids and extracts the DHS that has been translocated to the outer leaflet of the plasma membrane . Without BSA, the measured release is substantially reduced, emphasizing the importance of proper experimental design when studying Rsb1p function.

How can researchers genetically manipulate RSB1 for functional studies?

Several genetic approaches have been successfully employed to study RSB1 function:

Genetic ApproachMethodologyApplication
Gene deletionReplacing the RSB1 gene with selection markers (e.g., URA3)Creating Δrsb1 strains to study loss-of-function effects
Epitope taggingN-terminal tagging with 3xHA under native or heterologous promotersProtein detection, localization, and expression studies
Promoter replacementReplacing the native promoter with constitutive (e.g., TDH3) or inducible promotersControlling expression levels for dose-dependent studies
Site-directed mutagenesisIntroducing specific mutations (e.g., in the ATP binding motif)Structure-function relationship studies
Multicopy suppressionIntroducing RSB1 on high-copy plasmids in sensitive mutantsIdentifying genetic interactions and rescue phenotypes

Researchers have successfully created strains with 3xHA-tagged RSB1 under its native promoter by first replacing the RSB1 gene with a URA3 marker, then reintroducing the tagged version and selecting for the loss of URA3 using 5-fluoro-orotic acid . This approach allows for the detection of endogenous levels of Rsb1p using anti-HA antibodies while maintaining natural regulation of the gene.

What are the phenotypic assays used to evaluate RSB1 function in vivo?

Several phenotypic assays have been developed to assess RSB1 function in vivo:

  • PHS sensitivity assay: This measures growth inhibition in the presence of phytosphingosine (PHS). Strains lacking functional Rsb1p (Δrsb1) show increased sensitivity to exogenous PHS, while strains overexpressing RSB1 display resistance .

  • Growth inhibition assays: Various concentrations of sphingoid long-chain bases are added to cultures, and growth is monitored over time. This approach can be quantitative when combined with spectrophotometric measurements of culture density .

  • Genetic interaction assays: Combined deletions of RSB1 with other genes involved in sphingolipid metabolism (e.g., Δdpl1 Δrsb1 double mutants) reveal synthetic interactions that help place RSB1 in metabolic pathways .

  • Subcellular localization studies: Fluorescently tagged Rsb1p allows for visualization of its distribution between the ER and plasma membrane under various conditions .

These assays collectively provide a comprehensive understanding of RSB1's physiological role and can identify conditions that modulate its activity.

How is RSB1 transcriptionally regulated in yeast?

RSB1 transcription is regulated through a complex mechanism involving the pleiotropic drug resistance pathway. Key elements of this regulation include:

  • Transcription factors: Pdr1p, a major transcriptional regulator of the pleiotropic drug resistance network, controls RSB1 expression . Deletion of PDR1 results in dramatically reduced RSB1 expression, indicating that Pdr1p is a positive regulator of RSB1 .

  • Pleiotropic Drug Response Elements (PDREs): The RSB1 promoter contains two PDRE motifs (TCCGCGGA) located at positions -816 to -809 (PDRE-1) and -758 to -751 (PDRE-2) relative to the translational start site . Both elements are essential for full expression of RSB1, with removal of either element reducing expression and removal of both completely abolishing detectable RSB1 expression .

  • ABC transporter deletion effects: Interestingly, deletion of the ABC transporter genes PDR5 and YOR1 leads to upregulation of RSB1 at the transcriptional level . This represents a compensatory mechanism where the cell increases Rsb1p-mediated LCB export when other drug resistance transporters are compromised .

This regulatory network ensures appropriate RSB1 expression in response to cellular needs for sphingolipid homeostasis and drug resistance.

What factors influence the localization and stability of Rsb1p?

The subcellular localization and stability of Rsb1p are influenced by several factors:

Further research is needed to fully elucidate the determinants of Rsb1p localization and the factors that regulate its turnover within the cell.

What is the current understanding of Rsb1p's transport mechanism?

The exact transport mechanism of Rsb1p remains under investigation, with two primary models proposed:

  • Direct transporter model: In this model, Rsb1p functions as a conventional transporter that directly moves LCBs from the inner leaflet of the plasma membrane to the external medium . This would require a channel or pore through which the hydrophobic LCBs could travel.

  • Floppase model: Alternatively, Rsb1p may act as a floppase (translocase) that facilitates the movement of LCBs from the inner leaflet to the outer leaflet of the plasma membrane without directly releasing them to the medium . In this scenario, LCBs would remain within the membrane but change their orientation.

Current evidence suggests that whether Rsb1p functions as a direct transporter or a floppase, the net result is an increase in LCBs in the outer leaflet of the plasma membrane . These LCBs can then be extracted by proteins with high lipid affinity, such as bovine serum albumin (BSA) in experimental settings . The ATP-dependence of Rsb1p activity suggests a primary active transport mechanism, but the coupling between ATP hydrolysis and LCB movement has not been fully characterized at the molecular level .

How does Rsb1p contribute to sphingolipid homeostasis and signaling?

Rsb1p plays a multifaceted role in sphingolipid homeostasis and signaling:

  • Toxicity prevention: By exporting excess LCBs, Rsb1p helps prevent the accumulation of these potentially toxic compounds in the cytoplasm . This is particularly important because LCBs and their phosphorylated derivatives (LCBPs) act as signaling molecules that can inhibit cell growth when present at high concentrations .

  • Membrane asymmetry regulation: The translocation of LCBs between membrane leaflets contributes to the asymmetric distribution of sphingolipids, which is essential for proper membrane function . This asymmetry affects membrane curvature, fluidity, and the localization of membrane proteins.

  • Coordination with other pathways: Rsb1p's function is integrated with other sphingolipid metabolic pathways, including those mediated by Dpl1p (sphingoid base phosphate lyase) and various kinases and phosphatases that modify LCBs . This coordination ensures balanced sphingolipid metabolism.

  • Response to stress conditions: The regulation of Rsb1p expression through the pleiotropic drug resistance pathway suggests it participates in cellular stress responses, possibly by modulating membrane composition during adaptation to adverse conditions .

Understanding these contributions is crucial for developing a comprehensive model of how cells maintain sphingolipid homeostasis and respond to perturbations in lipid metabolism.

What are the implications of cross-talk between sphingolipids and glycerophospholipids for Rsb1p function?

The cross-talk between sphingolipids and glycerophospholipids has several implications for Rsb1p function:

How can researchers overcome difficulties in measuring Rsb1p activity in vitro?

Measuring the activity of membrane transporters like Rsb1p presents several technical challenges. Researchers can address these challenges through the following approaches:

  • Reconstitution in liposomes: Purified Rsb1p can be incorporated into artificial liposomes with defined lipid composition to study its transport activity in a controlled environment. This requires:

    • Optimization of detergent solubilization conditions to extract Rsb1p while maintaining its native structure

    • Selection of appropriate lipid mixtures that support protein function

    • Development of assays to measure LCB translocation across the liposomal membrane

  • Radiolabeled or fluorescent LCB analogs: Using modified LCBs that can be readily detected improves assay sensitivity. When designing such studies, researchers should:

    • Verify that the modified LCBs remain substrates for Rsb1p

    • Establish appropriate controls to account for non-specific binding and spontaneous flipping

    • Optimize signal-to-noise ratios by adjusting substrate concentrations and incubation times

  • ATP regeneration systems: Since Rsb1p activity is ATP-dependent, maintaining consistent ATP levels throughout the assay is crucial . This can be achieved by including:

    • Phosphocreatine and creatine kinase

    • ATP monitoring controls to verify stable ATP concentrations

    • Comparative studies with non-hydrolyzable ATP analogs to confirm ATP requirement

  • Extraction conditions: The high hydrophobicity of LCBs makes their extraction and quantification challenging. Effective methods include:

    • Lipid extraction protocols optimized for sphingolipids

    • HPLC or mass spectrometry-based quantification methods

    • The use of BSA as an LCB acceptor to facilitate extraction from membranes

By addressing these technical aspects, researchers can develop robust in vitro assays that accurately reflect Rsb1p's physiological activity.

What approaches can resolve contradictory data about Rsb1p localization and function?

When faced with contradictory data about Rsb1p localization and function, researchers can employ several strategies to resolve discrepancies:

  • Expression level considerations: Overexpression of Rsb1p may alter its localization compared to endogenous levels. Researchers should:

    • Compare results from native promoter-driven expression versus heterologous promoters

    • Use complementary approaches such as chromosomal tagging at the endogenous locus

    • Perform functional assays across a range of expression levels to determine dose-dependent effects

  • High-resolution imaging techniques:

    • Super-resolution microscopy to precisely determine membrane localization

    • Live-cell imaging to monitor dynamic changes in localization

    • Correlative light and electron microscopy to relate fluorescence signals to ultrastructural features

  • Biochemical fractionation validation:

    • Sucrose gradient fractionation combined with immunoblotting to separate cellular compartments

    • Protease protection assays to determine protein topology

    • Chemical crosslinking to capture transient protein-protein interactions

  • Genetic interaction mapping:

    • Systematic analysis of genetic interactions between RSB1 and genes involved in membrane trafficking

    • Suppressor screens to identify factors that restore function in rsb1 mutants

    • Conditional alleles to distinguish between direct and indirect effects

  • Substrate specificity reassessment:

    • Comprehensive analysis of transport activity across a wider range of potential substrates

    • Structure-activity relationship studies with modified LCBs

    • Competition assays to determine relative affinities for different sphingolipid species

By integrating multiple approaches and carefully controlling experimental variables, researchers can develop a more coherent understanding of Rsb1p biology and resolve apparent contradictions in the literature.

How might the study of RSB1 homologs in other organisms advance our understanding of sphingolipid transport?

Comparative analysis of RSB1 homologs across species represents a powerful approach to understanding fundamental principles of sphingolipid transport:

  • Evolutionary conservation analysis: Identifying conserved domains and motifs across RSB1 homologs can reveal critical functional regions of the protein. This approach can:

    • Highlight catalytic residues that have remained invariant through evolution

    • Identify species-specific adaptations that reflect different membrane compositions or physiological requirements

    • Reveal potential regulatory domains that modulate transport activity

  • Functional complementation studies: Testing whether RSB1 homologs from other organisms can rescue phenotypes in yeast rsb1 mutants can provide insights into functional conservation. This approach can determine:

    • Whether the basic transport mechanism is conserved across species

    • If substrate specificity has diversified during evolution

    • Whether regulatory mechanisms are transferable between organisms

  • Structural biology approaches: Structures of RSB1 homologs from different species may be more amenable to crystallization or cryo-EM analysis than yeast Rsb1p. Structural information would:

    • Reveal the molecular architecture of the transport pathway

    • Identify substrate binding sites and conformational changes during the transport cycle

    • Guide rational design of inhibitors or activators for functional studies

  • Disease-associated variants: Analysis of human homologs implicated in diseases can connect fundamental transport mechanisms to pathological processes, potentially:

    • Revealing how defects in sphingolipid transport contribute to disease pathogenesis

    • Identifying therapeutic targets for disorders of sphingolipid metabolism

    • Providing insights into physiological roles of sphingolipid asymmetry in complex organisms

These approaches collectively offer a path to a more comprehensive understanding of sphingolipid transport mechanisms across biology.

What potential biotechnological applications could arise from better understanding of RSB1 function?

Advanced understanding of RSB1 function could enable several biotechnological applications:

  • Engineered yeast strains for sphingolipid production:

    • Modified Rsb1p variants with altered substrate specificity or activity could enhance production of specific sphingolipids

    • Controlled expression of RSB1 could modulate the intracellular levels of bioactive sphingolipids

    • Integration with other sphingolipid pathway modifications could create optimized production platforms

  • Biosensors for sphingolipid detection:

    • Rsb1p-based biosensors could be developed to detect sphingolipids in biological samples

    • Conformation-sensitive fluorescent tags on Rsb1p might report on substrate binding

    • Coupling Rsb1p activity to reporter systems could enable high-throughput screening assays

  • Membrane engineering applications:

    • Controlled expression of Rsb1p could be used to alter membrane asymmetry for specialized functions

    • Rsb1p-mediated changes in membrane composition might enhance yeast resistance to industrial stressors

    • Designer membranes with specific sphingolipid distributions could improve bioproduction processes

  • Therapeutic target development:

    • Understanding the mechanistic basis of sphingolipid transport could inform the design of modulators for human homologs

    • Rsb1p-inspired peptides or small molecules might serve as leads for drugs targeting sphingolipid transporters

    • Yeast-based screening systems incorporating RSB1 could identify compounds that affect sphingolipid trafficking

These applications represent the potential translation of fundamental RSB1 research into biotechnological innovations with academic and industrial relevance.

How does the interplay between RSB1 and the pleiotropic drug resistance network inform our understanding of membrane homeostasis?

The relationship between RSB1 and the pleiotropic drug resistance (PDR) network provides important insights into membrane homeostasis:

  • Integrated stress responses: The transcriptional regulation of RSB1 by Pdr1p, a master regulator of the PDR network, suggests that sphingolipid transport is coordinated with broader cellular stress responses . This coordination may:

    • Ensure appropriate membrane composition during exposure to xenobiotics

    • Maintain signaling competence under stress conditions

    • Prevent accumulation of toxic lipid species during metabolic adaptation

  • Compensatory transport mechanisms: The upregulation of RSB1 in pdr5 and yor1 mutants demonstrates that cells can compensate for deficiencies in one transport system by enhancing others . This reveals:

    • Functional redundancy within membrane transport networks

    • Sensing mechanisms that detect alterations in membrane composition

    • Transcriptional feedback loops that maintain membrane homeostasis

  • Regulatory hierarchy within transport systems: The presence of PDREs in the RSB1 promoter and its dependence on Pdr1p establishes RSB1 as an integral component of the PDR network . This integration suggests:

    • A hierarchical organization of transport systems

    • Coordinated regulation of multiple transporters to achieve balanced membrane composition

    • Evolutionary selection for regulatory mechanisms that optimize cellular responses to environmental challenges

  • Membrane compartmentalization principles: The relationship between sphingolipid transport and drug resistance highlights the importance of membrane composition in determining permeability to various compounds. This connection illuminates:

    • How cells maintain selective permeability through controlled lipid distribution

    • The role of lipid asymmetry in modulating membrane protein function

    • Principles that could guide the design of more effective therapeutic agents that overcome resistance mechanisms

These insights extend beyond the specific function of Rsb1p to inform our understanding of how cells maintain membrane homeostasis through integrated transport and regulatory networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.