Recombinant Saccharomyces cerevisiae Spore membrane assembly protein 2 (SMA2)

Shipped with Ice Packs
In Stock

Description

Introduction to SMA2

SMA2 (YML066C) is a meiosis-specific protein essential for prospore membrane assembly during sporulation in Saccharomyces cerevisiae. It ensures proper bending and closure of the prospore membrane to encapsulate haploid nuclei post-meiosis .

Gene and Protein Overview

  • Gene: SMA2 is located on chromosome XIII and regulated by the transcription factor Ndt80 during the middle sporulation phase .

  • Protein: SMA2 is a 294-amino acid protein with no conserved domains but shares structural similarities with other prospore membrane components like Spo74 .

Recombinant Production

PropertyDetail
SourceEscherichia coli (E. coli) expression system
Purity>85% (SDS-PAGE verified)
StorageLyophilized form stable at -20°C/-80°C for 12 months
ReconstitutionRequires deionized sterile water; glycerol (5–50%) recommended
UniProt IDA6ZLZ9

Key Activities

  • Prospore Membrane Bending: SMA2 generates mechanical force to curve the prospore membrane, ensuring proper engulfment of haploid nuclei .

  • Interaction Network: Collaborates with Spo21/Mpc70 and Spo74 to form the meiosis II outer plaque (MOP), a structure critical for membrane assembly .

Regulatory Mechanisms

  • Transcriptional Control: Co-induced with mORC1 via a bidirectional promoter element activated by Ndt80 during meiosis .

  • Post-Translational Modifications: Requires phosphorylation by kinases such as Ime2 for functional activation .

Experimental Use Cases

  • Sporulation Studies: Used to investigate prospore membrane dynamics and genetic interactions in yeast sporulation mutants .

  • Protein Interaction Mapping: Identified 223 interactors via BioGRID, including Spo74 and components of the spindle pole body .

Limitations

  • Partial-Length Protein: The recombinant product lacks full-length sequence coverage, potentially omitting functional domains .

  • Species Specificity: Functionally distinct from human SMN proteins involved in spinal muscular atrophy .

Key Research Findings

Study FocusOutcomeSource
Genetic Deletionsma2Δ mutants exhibit defective prospore membranes and spore viability .BioGRID, PMC
Expression ProfileInduced during middle sporulation phase; absent in vegetative growth .PMC, SGD
Structural AnalysisLocalizes to the cytoplasmic face of spindle pole bodies during meiosis II .PMC, BioGRID

Future Directions

  • Full-Length Protein Synthesis: Addressing current limitations in recombinant SMA2 coverage to enable structural studies.

  • Mechanistic Studies: Elucidating how SMA2-generated forces are transmitted to the prospore membrane.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
SMA2; SCY_4111; Spore membrane assembly protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SMA2
Target Protein Sequence
MLFPKRLIVWGVLLILSLSQFVLYLPATTCTNSKGLRLCAPQFTITVIGGSSTANEFIAS VREFLRLISYLTIDMGWSNEFTDPSVYEDENLVDTFQPDKVFELNYFGFCKRSNKSKVYC TSNENYGMDVLEVLVRDVGIQLGNISTTRSNETKKFGDSLVLTYRLALTSIRDFLKHDKH TGNALSKALIGSPDPNVKGASPTKNYLKGVNLAFILMMFNGMVFYFAVLEIIVGFLSICV VSAFGGALSVGKRHRLFPILLKSSSSILVVIATLTILCNIVYLIALKTLEPEEVTDVGSD NAAVHTTGWELLKVNVGSGFIMGLARYAIQWVLLVLAFLAANHYKAKPKKSDKYTEDTSN SPSPDLMEK
Uniprot No.

Target Background

Function
SMA2 (Spore membrane assembly protein 2) plays a crucial role in spore and ascus formation in Saccharomyces cerevisiae. It is essential for the efficient assembly of prospore membrane precursors into a continuous prospore membrane.
Protein Families
SMA2 family
Subcellular Location
Prospore membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.