Recombinant Saccharomyces cerevisiae Squalene synthase (ERG9)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Squalene Synthase (ERG9)

Saccharomyces cerevisiae Squalene synthase (ERG9) is a vital enzyme in sterol biosynthesis . Specifically, ERG9 is the gene that encodes squalene synthase in Saccharomyces cerevisiae . Squalene synthase, the first enzyme specific to the cholesterol biosynthetic pathway, catalyzes the conversion of farnesyl diphosphate (FPP) to squalene via presqualene diphosphate, a two-step process that requires both Mg2+ and NADPH . As the initial dedicated step in sterol synthesis, ERG9's regulation is complex and multifaceted, influenced by various factors to ensure appropriate sterol production without disrupting isoprenoid synthesis .

Gene and Protein Information

Gene NameERG9
OrganismSaccharomyces cerevisiae
Enzyme ClassSqualene Synthase (EC 2.5.1.21)
FunctionCatalyzes the synthesis of squalene from farnesyl diphosphate
AliasesSQS, SS, FPP:FPP farnesyltransferase, Farnesyl-diphosphate farnesyltransferase

Production and Purification

Recombinant ERG9 can be produced in various hosts, including E. coli, yeast, baculovirus, or mammalian cells . A common approach involves modifying the ERG9 gene using PCR to remove a hydrophobic C-terminal domain, which can then be cloned into expression vectors . Overexpressed truncated squalene synthase in E. coli is soluble, making up 2-5% of total cellular protein, and can be purified to over 95% homogeneity using chromatography techniques such as hydroxyapatite and phenyl-Superose .

Enzymatic Activity and Kinetics

Soluble truncated squalene synthase functions as a monomer, catalyzing FPP into squalene through presqualene diphosphate in the presence of Mg2+ and NADPH . The enzyme's activity is influenced by FPP concentration, with a concentration of 40 μM required for half-maximal activity and higher concentrations acting as inhibitors . Detergents like Tween 80 can stimulate squalene synthase activity, reaching a maximal value of kcat = 3.3 s-1 at 100 μM FPP with 1% Tween 80 .

Regulation of ERG9 Expression

ERG9 transcription is regulated by multiple factors, reflecting the importance of sterol synthesis . Mutants with sterol biosynthetic mutations (ERG3, ERG7, ERG24) can increase ERG9 expression . Sterol inhibitors like zaragozic acid and ketoconazole, which target squalene synthase and C-14 sterol demethylase, also elevate ERG9 expression . Heme mutants show increased ERG9 expression, while anaerobic conditions reduce it . Transcription factors such as HAP1, HAP2/3/4, yAP-1, and the INO2/4 complex regulate ERG9 expression, with hap1, hap2/3/4, and yap-1 mutants decreasing ERG9 expression and ino2/4 mutants increasing it .

Metabolic Engineering for Squalene Production

Metabolic engineering strategies often involve manipulating ERG9 and related genes to enhance squalene production . Overexpressing genes like farnesyl diphosphate synthase (ispA) and a truncated HMG-CoA reductase (tHMG1) in S. cerevisiae strains can significantly increase squalene production . For example, the S. cerevisiae Y2805 strain, when engineered this way, can produce high levels of squalene, reaching 400 ± 45 mg/L in shake flasks . Further inhibition of squalene epoxidase by terbinafine can increase squalene production by up to 1.9-fold, achieving 756 ± 36 mg/L . Fed-batch fermentations can yield even higher squalene production, reaching 2011 ± 75 mg/L with terbinafine supplementation and 1026 ± 37 mg/L without it .

StrainGenetic ModificationsSqualene Production (Shake Flasks)Squalene Production (Fed-Batch)Terbinafine
Y2805ispA, tHMG1 overexpression400 ± 45 mg/L1026 ± 37 mg/LAbsent
Y2805ispA, tHMG1 overexpression756 ± 36 mg/L2011 ± 75 mg/LPresent

Physiological and Metabolic Effects of Squalene Overproduction

Physiological characterization of squalene-overproducing S. cerevisiae strains reveals metabolic bottlenecks and guides metabolic engineering efforts . Carbon catabolite repression during growth on glucose reduces acetyl-CoA availability for the mevalonate (MVA) pathway, limiting squalene accumulation . Ethanol metabolism increases flux into the MVA pathway, enhancing squalene synthesis . Limitations in redox cofactor and CoA availability also affect squalene production, highlighting the need for optimizing cofactor synthesis pathways and media composition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG9; YHR190W; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERG9
Target Protein Sequence
MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIREL HPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDR AVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCH YVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPK EIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQ VMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQD PNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYK FNMVLSIILSVLLGFYYIYTLHRA
Uniprot No.

Target Background

Function

Saccharomyces cerevisiae Squalene synthase (ERG9) catalyzes the condensation of two farnesyl pyrophosphate moieties to form squalene. This enzyme initiates the sterol biosynthesis pathway, crucial for ergosterol biosynthesis. It may also play a regulatory role in the sterol pathway, balancing farnesyl diphosphate (FPP) incorporation into sterol and non-sterol isoprene synthesis. ERG9 is essential for yeast cell growth.

Gene References Into Functions
  1. Restoration of full complementation was mapped to a 26-amino acid hinge region connecting the catalytic and membrane-spanning domains, unique to fungal squalene synthases. PMID: 27320012
  2. Engineered strains showed a 2- to 5-fold improvement in amorpha-4,11-diene production compared to a reference strain, with ERG9 under its native promoter. PMID: 25889168
Database Links

KEGG: sce:YHR190W

STRING: 4932.YHR190W

Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome.

Q&A

What is the ERG9 gene in Saccharomyces cerevisiae and what protein does it encode?

The ERG9 gene in Saccharomyces cerevisiae encodes squalene synthase, which catalyzes the first pathway-specific reaction in the sterol biosynthetic pathway. This enzyme performs the two-step conversion of farnesyl diphosphate (FPP) to squalene via presqualene diphosphate in the presence of Mg²⁺ and NADPH . The gene has been isolated, sequenced, and characterized (GenBank accession number: AB009978 for C. glabrata ERG9) . Squalene synthase represents a critical branch point in isoprenoid metabolism, as it diverts carbon flux specifically toward sterol synthesis from other essential isoprenoid pathways .

How does squalene synthase function in the ergosterol biosynthetic pathway?

Squalene synthase occupies a pivotal position in the ergosterol biosynthetic pathway:

Position in PathwayUpstream EnzymeSqualene Synthase (ERG9)Downstream Enzyme
SubstrateFarnesyl diphosphate (FPP)Squalene
EnzymeFarnesyl diphosphate synthase (Erg20p)Squalene synthase (Erg9p)Squalene epoxidase (Erg1p)
ProductFPPSqualene2,3-oxidosqualene

What are the optimal strategies for expressing and purifying recombinant ERG9 protein?

The optimal strategy for expressing and purifying recombinant squalene synthase involves:

  • Modification of the structural gene: Remove the hydrophobic C-terminal domain using PCR to produce a soluble, truncated enzyme that retains catalytic activity .

  • Expression system selection: Both yeast and E. coli expression systems are viable. In E. coli, the recombinant enzyme typically constitutes 2-5% of total cellular protein and remains soluble .

  • Purification protocol:

    • First step: Hydroxyapatite chromatography

    • Second step: Phenyl-Superose chromatography

    • This two-step process yields >95% homogeneity

  • Activity optimization: Include detergents such as Tween 80, which stimulates enzyme activity. Maximum activity (kcat = 3.3 s⁻¹) is observed at 100 μM FPP in the presence of 1% (v/v) Tween 80 .

  • Reaction conditions: Ensure the presence of Mg²⁺ and NADPH, which are required cofactors for the enzymatic reaction .

For structural and functional studies, this approach provides high-quality, active enzyme suitable for detailed biochemical characterization.

How can ERG9 expression be modified to enhance production of terpenes and other valuable compounds?

Several strategies have been developed to modify ERG9 expression for enhanced terpene production:

Table 1: Strategies for ERG9 Modification in Terpene Production

StrategyMechanismExample ApplicationOutcomeReference
Dynamic promoter controlReplace native ERG9 promoter with P_ERG1 (ergosterol-sensitive)Casbene productionImproved diterpene yields
Glucose-responsive regulationReplace native ERG9 promoter with P_HXT1 (glucose-sensing)Diterpene productionMetabolic state-dependent ERG9 regulation
CRISPR/Cas9 manipulationPrecise genetic modification of ERG9Friedelin production65-fold higher yield compared to wild-type
Combined pathway engineeringModify ERG9 alongside other pathway genes (ERG20, tHMG1)Various terpenesComprehensive pathway optimization

The fundamental principle is to reduce carbon flux through the sterol pathway by controlling ERG9 expression, thereby increasing the availability of FPP for terpene synthases. In the casbene production study, strains with engineered ERG9 expression showed substantial improvements in diterpene production . For optimal results, ERG9 modification should be implemented as part of a comprehensive metabolic engineering strategy that includes manipulation of multiple pathway enzymes.

What are the effects of ERG9 deletion or downregulation on S. cerevisiae viability and metabolism?

The effects of ERG9 manipulation on yeast physiology are significant:

  • Complete deletion: Lethal under standard laboratory conditions, as ergosterol is essential for membrane structure and function .

  • Controlled downregulation: Can be achieved using regulatable promoters such as tetracycline-responsive systems. In C. glabrata (related to S. cerevisiae), depletion of ERG9 decreased cell viability in laboratory media .

  • Exogenous sterol supplementation: The growth defect caused by ERG9 downregulation can be suppressed by adding serum, which contains cholesterol. Analysis of sterol composition shows that cells can incorporate exogenous cholesterol to complement the defect in ergosterol biosynthesis .

  • Metabolic consequences:

    • Accumulation of upstream metabolites, particularly FPP

    • Redirection of carbon flux toward alternative FPP-derived products

    • Altered membrane composition

    • Changes in cell morphology and growth characteristics

  • Engineering implications: Moderate downregulation of ERG9, rather than complete knockout, is preferred for metabolic engineering applications to balance flux redirection with cell viability .

Understanding these effects is crucial for designing effective metabolic engineering strategies that maintain adequate cell function while redirecting metabolic flux toward desired products.

How can CRISPR/Cas9 technology be utilized for ERG9 manipulation in S. cerevisiae?

CRISPR/Cas9 technology offers precise approaches for ERG9 manipulation in S. cerevisiae:

  • Promoter replacement workflow:

    • Design guide RNAs (gRNAs) targeting the ERG9 promoter region

    • Construct Cas9 expression vector (e.g., P414-Leu-TEF1p-Cas9-CYC1t)

    • Prepare homologous repair fragments containing the desired promoter

    • Transform components into yeast cells

    • Verify modifications through PCR and sequencing

    • Remove CRISPR components using 5-fluoroorotic acid selection

  • Knockdown approaches:

    • CRISPR interference (CRISPRi) using catalytically inactive Cas9

    • Introduction of specific mutations in regulatory regions

    • Targeted modification of the endogenous promoter

  • Multiplexed engineering:
    In the friedelin production study, CRISPR/Cas9 enabled the creation of quadruple mutants affecting multiple pathway genes simultaneously . This approach allows for comprehensive pathway engineering in a single transformation.

  • Structure-function studies:
    CRISPR/Cas9 allows precise introduction of point mutations to study specific residues in the catalytic domain, enabling detailed structure-function analysis.

The precision and efficiency of CRISPR/Cas9 make it particularly valuable for ERG9 modification in metabolic engineering applications, as demonstrated in the high-yielding friedelin-producing strain GQ1 .

How is ERG9 expression regulated in S. cerevisiae under normal conditions?

ERG9 expression in S. cerevisiae is regulated through multiple mechanisms:

  • Feedback regulation: Expression is influenced by intracellular sterol levels, with high ergosterol levels downregulating ERG9 expression through ergosterol-responsive elements.

  • Transcription factors: Proteins such as Upc2p and Rox1p play important roles in regulating ERG9 expression. ROX1 encodes a repressor that regulates ERG9 and other genes under hypoxic conditions .

  • Oxygen sensitivity: Since ergosterol biosynthesis is oxygen-dependent, oxygen availability affects ERG9 expression.

  • Carbon source responsiveness: ERG9 expression varies with carbon source availability and general cellular metabolism, as evidenced by studies using glucose-sensing promoters to control expression .

Understanding these regulatory mechanisms has enabled the development of dynamic control strategies for ERG9 expression in metabolic engineering applications.

What methods are commonly used to study ERG9 expression in yeast?

Several methods are employed to study ERG9 expression at different levels:

Table 2: Methods for Analyzing ERG9 Expression

MethodApplicationAdvantagesExample Use
Real-time RT-PCRQuantification of mRNA levelsHighly sensitive, quantitativeMeasuring ERG9 expression changes after treatment with Matricaria recutita extract
Promoter replacementStudying effects of controlled expressionAllows precise regulationReplacing native ERG9 promoter with P_ERG1 or P_HXT1
Western blottingProtein level detectionDirect measurement of protein abundanceQuantifying Erg9p levels under various conditions
Enzyme activity assaysFunctional analysisDirectly measures catalytic functionMonitoring conversion of FPP to squalene
GC-MS/LC-MSMetabolite profilingMeasures pathway productsAnalyzing sterol composition of cells with modified ERG9

These complementary approaches provide a comprehensive understanding of ERG9 expression and function. For example, in a study examining the effect of Matricaria recutita extract, real-time RT-PCR revealed that concentrations of 250, 1000, and 3000 μg/ml significantly reduced ERG9 expression, with complete inhibition at the higher concentrations .

How does squalene synthase from S. cerevisiae compare to squalene synthases from other organisms?

Squalene synthase is conserved across diverse organisms but shows important variations:

Table 3: Comparison of Squalene Synthases Across Species

OrganismGene NameNotable FeaturesSequence ConservationAccession Number
S. cerevisiaeERG9Hydrophobic C-terminal domainReferenceM63979
C. albicansERG9Similar function in pathogenic fungusHigh homology to S. cerevisiaeD89610
C. glabrataCgERG9Can be complemented by exogenous sterolsHigh homology to S. cerevisiaeAB009978
S. pombe--Moderate homologyL06071
HumanFDFT1Target for cholesterol-lowering drugsModerate homologyX69141
A. thaliana-Plant isoprenoid pathwayLower homologyD29017

Conservation analysis has been used to design degenerate primers for amplifying squalene synthase genes across species . The basic catalytic function—conversion of FPP to squalene via presqualene diphosphate—is conserved, though regulatory mechanisms may differ. This conservation has implications for antifungal drug development and for translating findings between systems.

What are the implications of ERG9 regulation for antifungal drug development?

The implications of ERG9 research for antifungal drug development reveal important considerations:

  • Initial promise: Squalene synthase was initially considered an attractive target for antifungal compounds because it catalyzes the first committed step in sterol biosynthesis, and its inhibition is lethal to yeast under standard laboratory conditions .

  • Unexpected complications: Studies with Candida glabrata revealed that depletion of ERG9 decreased cell viability in laboratory media but surprisingly did not affect fungal growth in mice . This was attributed to the ability of C. glabrata to incorporate exogenous cholesterol from serum, thereby bypassing the need for endogenous ergosterol synthesis .

  • Sterol incorporation mechanism: Analysis of sterol composition confirmed that fungal cells could adapt by incorporating host cholesterol when their endogenous sterol synthesis was compromised .

  • Drug development implications: These findings suggest that squalene synthase inhibitors alone might not be effective for treating infections caused by fungi capable of utilizing host sterols. Combination approaches targeting both synthesis and uptake may be necessary .

  • Research value: Despite limitations as a singular drug target, C. glabrata with regulatable ERG9 serves as "an attractive experimental model to understand molecular responses of Candida species to antifungal compounds" .

This research highlights the importance of considering alternative metabolic pathways and adaptation mechanisms when developing antifungal drugs targeting the sterol biosynthesis pathway.

What are the key considerations for designing experiments involving dynamic regulation of ERG9 expression?

When designing experiments with dynamic ERG9 regulation, researchers should consider:

Table 4: Promoter Systems for Dynamic ERG9 Regulation

PromoterResponse MechanismAdvantagesLimitationsExample Application
P_ERG1Senses intracellular ergosterol levelsPhysiological feedback controlMay have limited dynamic rangeImproved casbene production
P_HXT1Responds to glucose availabilityLinks expression to carbon sourceMay not provide fine controlMetabolic state-dependent regulation
Tetracycline-regulatedResponds to tetracycline/doxycyclineExternal, dose-dependent controlRequires additional genetic componentsERG9 depletion studies in C. glabrata

Additionally, implementation considerations include:

  • Integration method: Homologous recombination techniques or CRISPR/Cas9 technology for precise promoter replacement .

  • Verification protocols: PCR-based methods and sequencing to confirm correct modifications .

  • Expression monitoring: Real-time RT-PCR, Western blotting, or reporter systems to track expression levels .

  • Physiological assessment: Comprehensive evaluation of growth characteristics, metabolite profiles, and target product yields .

  • Optimization strategy: Titration experiments and time-course studies to find the optimal balance between ERG9 downregulation and cell viability .

In the casbene production study, strains with P_ERG1-ERG20 showed significantly improved diterpene production compared to control strains, demonstrating the effectiveness of dynamic regulation strategies .

What experimental approaches are best for studying the effects of point mutations in ERG9?

Several complementary approaches are optimal for studying point mutations in ERG9:

  • Mutagenesis techniques:

    • Site-directed mutagenesis via PCR

    • CRISPR/Cas9-mediated genome editing

    • Degenerate oligonucleotide-directed mutagenesis for systematic exploration

  • Functional complementation:

    • Expression of mutated ERG9 in ERG9-deficient strains maintained with exogenous sterols

    • Growth assessment upon shifting to media without sterol supplementation

    • Quantitative measurement of complementation efficiency

  • Enzyme kinetics analysis:

    • In vitro assays with purified recombinant enzyme

    • Determination of kinetic parameters (Km, kcat, substrate inhibition profiles)

    • Comparison with wild-type enzyme benchmarks (e.g., wild-type squalene synthase has a Km for FPP of approximately 40 μM)

  • Metabolic profiling:

    • LC-MS/GC-MS analysis of sterol profiles

    • Detection of pathway intermediates or alternative products

    • Comprehensive pathway flux analysis

  • Growth and stress response characterization:

    • Phenotypic assays under various conditions (temperature, osmotic stress, antifungals)

    • Assessment of membrane properties and integrity

    • Cell morphology examination

These approaches, used in combination, provide comprehensive insights into structure-function relationships in the ERG9 protein, facilitating both fundamental understanding and applied engineering of the enzyme.

What regulatory considerations should researchers be aware of when working with recombinant S. cerevisiae expressing modified ERG9?

Researchers working with recombinant S. cerevisiae expressing modified ERG9 must address several regulatory considerations:

  • NIH Guidelines compliance:

    • Institutions receiving NIH funding must follow the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules

    • The 2013 amendment explicitly extended coverage to include synthetic nucleic acids

    • Researchers must determine which section of the guidelines applies to their specific work

  • Institutional Biosafety Committee (IBC) approval:

    • Research involving recombinant or synthetic nucleic acids typically requires IBC review and approval before initiation

    • The level of review depends on the specific modifications and potential risks

    • Documentation of exempt status may be required even for lower-risk work

  • Risk assessment factors:

    • S. cerevisiae is generally considered a Biosafety Level 1 (BSL-1) organism

    • Modifications affecting sterol metabolism typically reduce viability rather than enhance pathogenicity

    • Specific context of the modifications must be considered in risk evaluation

  • Containment requirements:

    • Standard BSL-1 practices are sufficient for most S. cerevisiae work

    • Specific modifications might warrant additional precautions based on risk assessment

  • Documentation and reporting protocols:

    • Maintain proper documentation of strain construction and safety evaluations

    • Report adverse events or unexpected outcomes to appropriate institutional authorities

    • NIH-funded research may require reporting certain incidents to the NIH Office of Science Policy

  • Material transfer considerations:

    • Execute appropriate material transfer agreements when sharing engineered strains

    • Inform recipients about regulatory status and handling requirements

By addressing these regulatory considerations proactively, researchers can ensure compliance while advancing their scientific objectives related to ERG9 modification in S. cerevisiae.

What are the emerging approaches for studying and manipulating ERG9 in yeast?

Several emerging approaches show promise for advancing ERG9 research:

  • Systems biology integration:

    • Genome-scale metabolic models to predict the effects of ERG9 modifications

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to comprehensively analyze pathway responses

    • Machine learning approaches to identify optimal ERG9 expression levels for specific applications

  • Advanced protein engineering:

    • Directed evolution of ERG9 for altered substrate specificity or improved catalytic efficiency

    • Computational design of ERG9 variants with enhanced stability or activity

    • Creation of chimeric enzymes combining domains from different species' squalene synthases

  • Subcellular organization optimization:

    • Synthetic organelles for compartmentalized isoprenoid biosynthesis

    • Membrane engineering to optimize ERG9 localization and function

    • Protein scaffolding to create metabolic channeling between ERG9 and partner enzymes

  • Dynamic regulatory circuits:

    • Synthetic feedback loops for autonomous regulation of ERG9 expression

    • Optogenetic control systems for spatiotemporal regulation of ERG9 activity

    • Cell-free expression systems for rapid prototyping of ERG9 variants

  • Novel analytical techniques:

    • Single-cell metabolomics to understand cell-to-cell variation in ERG9 activity

    • Advanced imaging methods to visualize ERG9 localization and dynamics

    • High-throughput screening platforms for ERG9 inhibitors or enhancers

These approaches represent the frontier of ERG9 research and will likely yield valuable insights into both fundamental biology and applied biotechnology in the coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.