Recombinant Saccharomyces cerevisiae Stationary phase protein 3 (SPG3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPG3; YDR504C; D9719.10; Stationary phase protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SPG3
Target Protein Sequence
MICYFLVVTINFLKEKTTICHYFVNIFSLFLFLFVFVFVFIFVYFFYVILFYRFCSLFTY FPANSIWYYLSIINIFFPLCFFLYENFTGRNRRKCSLFCLTLIKITYTSPNHGFMVTGKE KFEKLRD
Uniprot No.

Target Background

Function
Essential for survival during the stationary phase.
Database Links

KEGG: sce:YDR504C

STRING: 4932.YDR504C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SPG3 in Saccharomyces cerevisiae stationary phase adaptation?

SPG3 (Stationary Phase Protein 3) is critical for metabolic reprogramming during nutrient deprivation. Its primary role involves coordinating trehalose/glycogen accumulation, transcriptional activation of stress-responsive genes (HSP12, HSP26), and G<sub>1</sub> arrest maintenance. Experimental validation shows rim15Δ mutants (lacking Rim15p, a downstream effector of SPG3) exhibit defective trehalose synthesis (0.009 g/g protein vs. 0.199 g/g in wild type) and reduced thermotolerance (0.03% survival vs. 35.6% in wild type) under stationary phase conditions . Researchers should monitor these biomarkers using:

  • Trehalase/Tre6P synthase assays

  • β-galactosidase reporters for stress-gene induction

  • Flow cytometry to quantify G<sub>1</sub> arrest

How do researchers design experiments to study recombinant SPG3 expression dynamics?

Robust experimental designs for SPG3 studies require:

  • Strain selection: Use BY4741 or S288C backgrounds due to well-characterized stationary phase responses .

  • Growth conditions: Compare log-phase (OD<sub>600</sub> 0.5–0.8) vs. 4-day stationary-phase cultures in YPD (2% glucose) .

  • Validation: Pair SDS-PAGE (>85% purity) with functional assays (e.g., thermotolerance survival rates) .

  • Controls: Include rim15Δ mutants and cAMP-dependent protein kinase (cAPK)-deficient strains to isolate SPG3-specific effects .

Table 1: Key Metrics for SPG3 Functional Validation

ParameterWild Typerim15Δ Mutant
Trehalose (g/g protein)0.1990.009
Glycogen (mg/g protein)38.5311.36
Thermotolerance (% survival)35.60.03
SSA3–lacZ induction105.216.3
Data derived from stationary-phase cultures

What methodological challenges arise when detecting SPG3 in recombinant yeast systems?

Common pitfalls include:

  • Protein instability: SPG3 degrades rapidly if stored at >-80°C for >6 months . Reconstitute lyophilized protein in 50% glycerol for long-term stability.

  • Low abundance: Stationary-phase SPG3 constitutes <0.1% of total proteome . Enrich via:

    • TCA precipitation followed by anti-Spg3p immunoblotting

    • MALDI-TOF/TOF with Mascot database matching

  • Cross-reactivity: Anti-SPG3 antibodies may bind paralogs like Pdr5p. Validate specificity using spg3Δ knockout controls .

How do post-translational modifications regulate SPG3 activity during oxidative stress?

Phosphorylation at Thr55/Ser56 in the α5-subunit enhances SPG3’s proteolytic capacity under glucose restriction . Key methods to study this:

  • Phos-tag SDS-PAGE to separate phosphorylated isoforms

  • LC-MS/MS with neutral loss scanning for PTM identification

  • Site-directed mutagenesis (e.g., T55A/S56A mutants) to test functional impacts

Table 2: Proteasome Activity Under Glucose Restriction

ConditionChymotrypsin-like Activity (nmol/min/μg)
Standard glucose12.4 ± 1.2
Glucose-restricted18.9 ± 2.1*
20S proteasome activity increased 1.5-fold in restricted cells (p < 0.01)

How can researchers resolve contradictions in SPG3’s role in multidrug resistance (MDR)?

Discrepancies arise from:

  • Strain-specific effects: PDR1 mutations dominate MDR in BY4741 , masking SPG3 contributions.

  • Experimental endpoints: Survival assays (72 hr) vs. gene expression (24 hr) .
    Resolution strategies:

  • Isogenic strain comparisons: Use pdr1Δ backgrounds to isolate SPG3 effects .

  • Time-course analyses: Profile SNQ2/YOR1 promoters hourly using β-galactosidase reporters .

  • CRISPR-interference to titrate SPG3 expression independently of Pdr1/3 .

What systems biology approaches elucidate SPG3’s interactome during quiescence?

Integrate:

  • Chromatin mapping: Sir3-M.EcoGII fusions with Nanopore sequencing reveal SPG3’s role in heterochromatin spreading (e.g., 6R telomere boundary effects) .

  • Co-expression networks: STRING-db analysis links SPG3 to Rim15p (score 0.92), TOR1 (0.85), and PKA (0.79) .

  • Machine learning: Train classifiers on GO annotations (e.g., GO:0042594 response to starvation) to predict novel SPG3 regulators .

Methodological Recommendations

  • For gene silencing studies: Use temperature-sensitive SIR3 alleles (e.g., sir3-ts) to temporally control SPG3-associated chromatin remodeling .

  • For evolutionary analyses: Compare SPG3 orthologs in Schizosaccharomyces pombe (phylogenetic distance >250 MYA) to identify conserved stress-response motifs .

  • For proteostasis studies: Combine SPG3 overexpression with 20S proteasome inhibitors (MG132) to quantify ubiquitination dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.