Recombinant Saccharomyces cerevisiae Sterol O-acyltransferase 1 (ARE1)

Shipped with Ice Packs
In Stock

Description

Introduction to ARE1

ARE1 (Sterol O-acyltransferase 1) is one of two acyl-CoA:sterol acyltransferases (ASATs) in S. cerevisiae, alongside ARE2. While ARE2 preferentially esterifies ergosterol (the end-product of sterol biosynthesis), ARE1 primarily targets sterol intermediates such as lanosterol, facilitating their sequestration into lipid droplets . Recombinant ARE1 refers to the protein expressed heterologously (e.g., in E. coli) for biochemical and structural studies, enabling detailed analysis of its role in lipid metabolism.

Enzymatic Function and Substrate Specificity

ARE1 exhibits distinct substrate preferences compared to ARE2:

FeatureARE1ARE2
Primary SubstratesSterol precursors (e.g., lanosterol)Ergosterol
Fatty Acid SpecificityC16:1 and C18:1 acyl-CoASimilar to ARE1
Cellular RoleDetoxification of biosynthetic intermediatesStorage of ergosterol
Contribution to Steryl Esters~25%~75%

ARE1’s activity prevents accumulation of toxic sterol intermediates under conditions of impaired ergosterol biosynthesis (e.g., heme deficiency or anaerobic growth) .

Physiological Role

  • Sterol Homeostasis: Deletion of ARE1 and ARE2 abolishes steryl ester formation, leading to free sterol accumulation and increased susceptibility to terbinafine (an ergosterol biosynthesis inhibitor) .

  • Transcriptional Regulation:

    • ARE1 is upregulated during heme deficiency or sterol precursor accumulation .

    • ARE2 expression dominates under aerobic conditions and requires HAP1 transcription factor .

  • Subcellular Localization: Both ARE1 and ARE2 reside in the ER, confirmed by GFP fusion studies .

Anaerobic Adaptation

Under oxygen-limited conditions, ARE1 transcription increases fivefold, enabling esterification of lanosterol and other intermediates, while ARE2 is repressed . This regulatory shift highlights ARE1’s role in mitigating sterol toxicity during hypoxia.

Applications in Research

Recombinant ARE1 is utilized to:

  1. Study sterol trafficking and lipid droplet biogenesis.

  2. Investigate mechanisms of ACAT (acyl-CoA:cholesterol acyltransferase) enzymes, relevant to human diseases like atherosclerosis .

  3. Develop antifungal strategies targeting sterol homeostasis .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format in the order notes and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and serves as a reference for your consideration.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
ARE1; SAT2; YCR048W; YCR48W; Sterol O-acyltransferase 1; Sterol-ester synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ARE1
Target Protein Sequence
MTETKDLLQDEEFLKIRRLNSAEANKRHSVTYDNVILPQESMEVSPRSSTTSLVEPVEST EGVESTEAERVAGKQEQEEEYPVDAHMQKYLSHLKSKSRSRFHRKDASKYVSFFGDVSFD PRPTLLDSAINVPFQTTFKGPVLEKQLKNLQLTKTKTKATVKTTVKTTEKTDKADAPPGE KLESNFSGIYVFAWMFLGWIAIRCCTDYYASYGSAWNKLEIVQYMTTDLFTIAMLDLAMF LCTFFVVFVHWLVKKRIINWKWTGFVAVSIFELAFIPVTFPIYVYYFDFNWVTRIFLFLH SVVFVMKSHSFAFYNGYLWDIKQELEYSSKQLQKYKESLSPETREILQKSCDFCLFELNY QTKDNDFPNNISCSNFFMFCLFPVLVYQINYPRTSRIRWRYVLEKVCAIIGTIFLMMVTA QFFMHPVAMRCIQFHNTPTFGGWIPATQEWFHLLFDMIPGFTVLYMLTFYMIWDALLNCV AELTRFADRYFYGDWWNCVSFEEFSRIWNVPVHKFLLRHVYHSSMGALHLSKSQATLFTF FLSAVFHEMAMFAIFRRVRGYLFMFQLSQFVWTALSNTKFLRARPQLSNVVFSFGVCSGP SIIMTLYLTL
Uniprot No.

Target Background

Function
Sterol O-acyltransferase catalyzes the formation of steryl esters.
Database Links

KEGG: sce:YCR048W

STRING: 4932.YCR048W

Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ARE1 in Saccharomyces cerevisiae?

ARE1 encodes one of two acyl-CoA:sterol acyltransferases in S. cerevisiae that catalyze the synthesis of steryl esters. These enzymes play critical roles in sterol homeostasis by esterifying free sterols with fatty acids. While both ARE1 and ARE2 contribute to steryl ester synthesis, they have evolved different substrate specificities, suggesting complementary roles in sterol metabolism. Individual deletion of either gene has no effect on cell viability under standard laboratory conditions, indicating functional redundancy between these enzymes .

The importance of ARE1 becomes more apparent in natural environments rather than laboratory conditions. Studies have shown that double mutants lacking both ARE1 and ARE2 (are1are2) grow more slowly than wild-type after several rounds of cultivation in competitive growth experiments. This suggests that these enzymes provide fitness advantages in natural habitats, despite their apparent dispensability in controlled laboratory settings .

To understand ARE1 function fully, researchers should consider its role in context with other sterol metabolism pathways, particularly under different stress conditions where sterol composition and homeostasis might become more critical for cellular adaptation.

How does ARE1 differ structurally and functionally from ARE2?

While ARE1 and ARE2 both function as acyl-CoA:sterol acyltransferases, they exhibit distinct substrate preferences that reflect their different roles in sterol metabolism. ARE1 (SAT2p) demonstrates a broader substrate range, efficiently esterifying sterol precursors (primarily lanosterol) as well as ergosterol. In contrast, ARE2 (SAT1p) has a significant preference for ergosterol as a substrate .

Despite these differences in sterol substrate specificity, both enzymes show similar patterns of fatty acid utilization. This suggests that the structural differences between ARE1 and ARE2 primarily affect the sterol-binding domain rather than the regions involved in fatty acid recognition and transfer .

From an evolutionary perspective, the persistence of both enzymes with their complementary substrate preferences suggests an adaptive advantage in having two specialized enzymes rather than a single generalist enzyme. This specialization may allow more precise regulation of sterol metabolism under varying environmental conditions and developmental stages.

What are the cellular localization and expression patterns of ARE1?

ARE1 is localized in the endoplasmic reticulum (ER) of S. cerevisiae cells, as demonstrated by subcellular fractionation studies measuring ASAT activity in are1 and are2 deletion strains. This localization has been confirmed through fluorescence microscopy using hybrid proteins of Are1p fused to green fluorescent protein (GFP) .

The ER localization is consistent with the enzyme's function in lipid metabolism, as the ER serves as a major site for lipid synthesis and modification in eukaryotic cells. The specific ER distribution pattern of ARE1 may influence its access to different sterol substrates and integration with other lipid metabolism pathways.

Regarding expression, ARE1 shows distinct patterns under different growth conditions and developmental stages. Researchers investigating ARE1 should consider these expression dynamics when designing experiments, especially when studying phenotypes that may be affected by changes in sterol metabolism under specific environmental conditions.

What methodology should be used to characterize substrate specificity of ARE1?

To characterize the substrate specificity of ARE1, researchers should employ a combination of in vivo and in vitro approaches. In vivo characterization can be performed through lipid analysis of are1 and are2 deletion strains, which reveals the differential utilization of sterol substrates. ARE1 preferentially esterifies sterol precursors, particularly lanosterol, while also utilizing ergosterol .

For in vitro characterization, researchers can use purified or microsomal-associated ARE1 protein with various sterol substrates and radiolabeled or fluorescently tagged acyl-CoA donors. The following methodological approach is recommended:

  • Generate single deletion strains (are1Δ and are2Δ) and double deletion strains (are1Δare2Δ) using CRISPR/Cas9 or traditional homologous recombination techniques.

  • Isolate microsomes from these strains and wild-type controls.

  • Perform enzyme assays using different sterol substrates and measure steryl ester formation.

  • Extract and analyze lipids using thin-layer chromatography (TLC) or liquid chromatography-mass spectrometry (LC-MS).

These approaches will provide comprehensive insights into the substrate preferences of ARE1 and how they differ from those of ARE2.

What are effective methods for measuring ARE1 activity in yeast cells?

Measuring ARE1 activity in yeast cells can be approached through several complementary methods. The most direct approach involves measuring ASAT activity in subcellular fractions of wild-type and are1 deletion strains. The difference in activity between these strains can be attributed to ARE1 .

For more specific measurements, researchers can use the following protocol:

  • Isolate microsomal fractions from yeast cells using differential centrifugation.

  • Incubate these fractions with radiolabeled or fluorescently labeled acyl-CoA donors and various sterol substrates.

  • Extract and analyze the formed steryl esters using TLC, HPLC, or LC-MS.

  • Compare activity profiles between wild-type and mutant strains.

Another approach involves monitoring cellular sterol composition and steryl ester levels using lipid analysis techniques. In are1 deletion strains, changes in the profile of esterified sterols, particularly a reduction in esterified lanosterol and other sterol precursors, would indicate ARE1's normal activity pattern .

Researchers can also utilize reporter systems, such as fusing the ARE1 promoter to a reporter gene (e.g., LacZ or GFP) to study the regulation of ARE1 expression under different conditions, providing indirect insights into when and where ARE1 activity is required.

How can I create and validate ARE1 deletion or overexpression strains?

Creating ARE1 deletion or overexpression strains requires careful genetic manipulation and validation steps. For deletion strains, the CRISPR/Cas9 method offers an efficient approach. The following protocol is recommended based on established yeast genetic techniques:

For ARE1 deletion:

  • Design guide RNAs targeting the ARE1 locus using established tools.

  • Transform yeast cells with a Cas9-expressing plasmid and the guide RNA, along with a repair template containing selectable markers.

  • Select transformants on appropriate media and confirm deletion by PCR and sequencing.

For ARE1 overexpression:

  • Clone the ARE1 gene into a suitable expression vector under a strong promoter (e.g., TEF1 or PGK1).

  • Transform yeast cells with this construct, selecting for transformants on appropriate media.

  • Confirm overexpression by qRT-PCR or Western blot analysis.

Validation of these strains should include:

  • Molecular verification (PCR, sequencing, qRT-PCR, or Western blotting).

  • Phenotypic analysis, including growth curves under different conditions.

  • Lipid profile analysis to confirm changes in steryl ester composition.

  • Complementation tests to ensure phenotypes are specifically due to ARE1 manipulation.

These approaches ensure that the observed phenotypes are specifically due to ARE1 alteration rather than secondary effects or adaptation.

What techniques are most effective for visualizing ARE1 localization in vivo?

For visualizing ARE1 localization in vivo, fluorescence microscopy using hybrid proteins of Are1p fused to green fluorescent protein (GFP) has proven effective . This approach allows direct observation of protein localization in living cells without disrupting cellular architecture.

The recommended protocol includes:

  • Create a C-terminal or N-terminal GFP fusion of ARE1, ensuring the fusion does not disrupt protein function.

  • Express this fusion protein in wild-type or are1Δ yeast cells.

  • Visualize using confocal or fluorescence microscopy, with appropriate markers for cellular compartments.

  • Co-localize with ER markers to confirm endoplasmic reticulum localization.

For higher resolution analysis, immunogold electron microscopy can be employed using antibodies against ARE1 or epitope-tagged versions of the protein. This provides nanometer-scale resolution of protein localization.

Super-resolution microscopy techniques like STORM or PALM can also be used for more detailed visualization of ARE1 distribution within the ER network, potentially revealing specialized domains or associations with other proteins involved in lipid metabolism.

How can ARE1 be expressed and purified for biochemical studies?

For heterologous expression:

  • Clone the ARE1 gene into an appropriate expression vector with an affinity tag (His6, FLAG, etc.).

  • Express in systems suitable for membrane proteins, such as:

    • Yeast expression systems (S. cerevisiae or Pichia pastoris)

    • Baculovirus-infected insect cells

    • Cell-free expression systems with appropriate detergents or lipid nanodiscs

For purification:

  • Solubilize membranes using mild detergents (e.g., DDM, CHAPS, or digitonin).

  • Purify using affinity chromatography based on the chosen tag.

  • Consider additional purification steps like size exclusion or ion exchange chromatography.

  • Reconstitute the purified protein into liposomes or nanodiscs for functional studies.

For functional assays with purified ARE1:

  • Prepare substrate mixtures containing various sterols and acyl-CoA donors.

  • Incubate with purified ARE1 under optimal conditions.

  • Analyze reaction products using TLC, HPLC, or LC-MS.

These approaches allow detailed biochemical characterization of ARE1, including determination of kinetic parameters, substrate specificity, and the effects of potential inhibitors or activators.

What is the relationship between ARE1 and recombination hotspots in yeast?

ARE1 (YCR048R) has been identified as a significant recombination hotspot in yeast, making it an important locus for studying the mechanisms and evolution of recombination. Population genomic studies of wild yeast species like Saccharomyces paradoxus have shown that the ARE1 region corresponds to the well-known hottest hotspot in both experimental and population genomic analyses .

This hotspot appears to be conserved between different yeast populations and even between species, suggesting that there may be fundamental sequence or chromatin features contributing to elevated recombination rates in this region. In European populations of S. paradoxus, the ARE1 region shows particularly high recombination rates compared to chromosome averages .

The conservation of this hotspot across populations and species presents interesting questions about the evolutionary forces maintaining recombination hotspots. Unlike in mammals, where hotspots are often ephemeral due to the "hotspot paradox," the persistence of the ARE1 hotspot suggests different evolutionary dynamics in yeast recombination landscapes.

For researchers interested in recombination mechanisms, the ARE1 locus provides an excellent model for studying the sequence determinants and chromatin features that promote recombination initiation in yeast. The table below summarizes recombination rates at various hotspots including ARE1:

Hotspot RegionNumber of GenesAverage ρ (likelihood ratio, max ρ)European DivergenceFar East DivergenceGene Conversion Rate (x10^-6)GC Content (%)
ARE1 region-High (identified as hottest hotspot)----
Chromosome average-1.7 (0.18)0.9 (0.07)0.9 (0.07)5.3 (0.29)39 (0.4)

How does the phenotype of are1are2 double mutants differ between laboratory and natural environments?

While are1are2 double mutants grow similarly to wild-type strains under standard laboratory conditions despite completely lacking ASAT activity and steryl ester formation, their performance differs in natural environments and under stress conditions .

In growth competition experiments, are1are2 cells grow more slowly than wild-type after several rounds of cultivation, suggesting that Are1p and Are2p or the steryl esters they produce provide fitness advantages in natural environments that aren't immediately apparent in controlled laboratory settings .

Additionally, the double mutants show increased sensitivity to terbinafine, an inhibitor of ergosterol biosynthesis, compared to wild-type strains. This indicates that the ability to form steryl esters provides a buffer against perturbations in sterol metabolism .

The phenotypic differences between laboratory and natural conditions highlight important considerations for researchers:

  • Laboratory conditions may not reveal the full functional significance of genes involved in metabolic processes.

  • Competitive growth experiments over multiple generations can reveal subtle fitness effects not apparent in short-term experiments.

  • Challenge experiments using metabolic inhibitors can help uncover the protective roles of seemingly dispensable pathways.

These findings emphasize the importance of designing experiments that more closely mimic natural environmental conditions when studying the physiological roles of metabolic enzymes like ARE1.

What are the mechanisms of substrate selectivity between ARE1 and ARE2?

The differential substrate selectivity between ARE1 and ARE2 represents a fascinating case of enzyme specialization. ARE1 preferentially esterifies sterol precursors (mainly lanosterol) as well as ergosterol, while ARE2 has a significant preference for ergosterol .

Understanding the molecular basis of this selectivity requires structural and functional analyses. Several approaches can address this question:

  • Chimeric protein analysis: Creating fusion proteins between ARE1 and ARE2 can help identify domains responsible for substrate specificity.

  • Site-directed mutagenesis: Targeting conserved and divergent residues in the putative sterol-binding regions.

  • Molecular docking and simulation: In silico approaches can model interactions between different sterols and the enzyme active sites.

  • Crystallographic studies: Structural determination of ARE1 and ARE2 alone or in complex with substrates would provide definitive insights.

The evolutionary divergence in substrate specificity between these paralogous enzymes suggests adaptive advantages to having specialized enzymes for different sterols. This specialization may allow more precise regulation of sterol homeostasis, with ARE1 potentially playing a greater role in the esterification of sterol intermediates during active ergosterol synthesis or under conditions where sterol precursors accumulate.

How can ARE1 be targeted for biotechnological applications?

ARE1's role in sterol metabolism makes it an interesting target for biotechnological applications, particularly in areas related to lipid engineering and sterol modification. Several potential applications include:

  • Engineering sterol storage: Manipulating ARE1 and ARE2 expression could alter the composition and quantity of steryl esters in yeast, potentially useful for producing specific sterols or creating lipid bodies with defined compositions.

  • Production of sterol derivatives: Modifying ARE1 substrate specificity through protein engineering could enable the selective esterification of non-native sterols or sterol-like compounds, creating novel lipid products.

  • Stress resistance in industrial strains: Enhanced expression of ARE1 might improve industrial yeast strains' tolerance to certain stresses by facilitating better management of membrane lipid composition.

  • Biosensor development: ARE1 promoter or protein fusions could be developed as biosensors for sterol levels or perturbations in sterol metabolism.

For these applications, researchers should consider both the native regulation of ARE1 and potential engineering approaches. The endoplasmic reticulum localization of ARE1 should be maintained in engineered systems to ensure proper function, and the balance between ARE1 and ARE2 activities may need careful adjustment to achieve desired sterol esterification profiles.

Why might I observe inconsistent ARE1 expression or activity levels?

Inconsistent ARE1 expression or activity levels can stem from several experimental and biological factors. Understanding these potential sources of variability is crucial for robust experimental design and interpretation:

  • Growth phase effects: ARE1 expression may vary significantly depending on the growth phase of yeast cultures. Always standardize harvesting at specific growth phases (e.g., mid-log phase) for consistency.

  • Media composition: Lipid content in media can influence ARE1 expression through feedback regulation. Synthetic complete media with defined composition is preferable to complex media for consistent results.

  • Oxygen levels: Ergosterol biosynthesis is oxygen-dependent, and fluctuations in oxygen availability can affect the entire sterol metabolism network, including ARE1 regulation. Maintain consistent aeration across experiments.

  • Temperature fluctuations: Membrane fluidity changes with temperature, potentially triggering compensatory changes in lipid metabolism genes. Strict temperature control is essential.

  • Technical variations in activity assays: When measuring ASAT activity, ensure consistent microsomal preparation procedures, substrate concentrations, and assay conditions. Include internal standards and technical replicates.

  • Genetic background effects: Even minor differences in strain backgrounds can influence ARE1 expression and function. Always use isogenic strains for comparisons and maintain proper controls.

By systematically controlling these variables and including appropriate controls, researchers can reduce variability and obtain more consistent results in ARE1-related experiments.

What controls should I include when analyzing phenotypes of ARE1 mutants?

When analyzing phenotypes of ARE1 mutants, comprehensive controls are essential to ensure that observed effects are specifically attributable to ARE1 manipulation. The following controls should be included:

  • Wild-type parental strain: Essential for baseline comparison.

  • Single mutants (are1Δ and are2Δ): Help distinguish between ARE1-specific effects and those that manifest only when both ASAT enzymes are absent.

  • Complemented strains: ARE1 deletion strains complemented with plasmid-expressed ARE1 to confirm that phenotypes are specifically due to ARE1 absence.

  • Empty vector controls: For overexpression studies, include the same vector without the ARE1 gene.

  • Catalytically inactive ARE1 mutants: Distinguish between enzymatic and potential structural roles of the protein.

  • Different growth conditions: Test under standard conditions and relevant stress conditions (e.g., terbinafine treatment) to reveal conditional phenotypes .

  • Extended cultivation periods: Some phenotypes, like reduced fitness in are1are2 double mutants, only become apparent after several rounds of cultivation .

  • Appropriate time points: For dynamic processes like lipid remodeling, multiple time points should be analyzed.

How can I distinguish between direct and indirect effects of ARE1 manipulation?

Distinguishing between direct and indirect effects of ARE1 manipulation presents a significant challenge in functional studies. To address this challenge, researchers can employ several complementary approaches:

  • Acute vs. chronic manipulation: Compare the effects of acute inhibition (e.g., using temperature-sensitive alleles or inducible degradation systems) with those of constitutive deletion. Direct effects should manifest immediately after acute inhibition, while indirect effects may require time to develop.

  • Time-course analyses: Monitor changes in phenotypes, gene expression, and metabolite profiles at multiple time points after ARE1 manipulation to identify primary responses versus secondary adaptations.

  • Catalytically inactive mutants: Introduce point mutations that specifically abolish enzymatic activity without affecting protein expression or localization. This helps distinguish between catalytic and potential structural roles of ARE1.

  • Targeted metabolomics: Focus on immediate metabolic products and substrates of ARE1 (sterols and steryl esters) to identify direct biochemical consequences of manipulation .

  • Transcriptome analysis: Compare gene expression changes in early versus late responses to identify compensatory pathways activated in response to ARE1 manipulation.

  • Suppressor screening: Identify genetic suppressors of are1Δ phenotypes to map functional interactions and compensatory pathways.

These approaches, particularly when used in combination, can help delineate the direct consequences of ARE1 function from the broader cellular adaptations that occur in response to perturbations in sterol metabolism.

What are common pitfalls in ARE1 localization studies?

When studying ARE1 localization using fluorescent protein fusions or other approaches, researchers should be aware of several common pitfalls that can lead to misleading results:

  • Fusion protein functionality: GFP or other tags may interfere with ARE1 folding, activity, or interactions. Always validate that the fusion protein retains enzymatic activity and can complement are1Δ phenotypes .

  • Overexpression artifacts: Excessive expression of ARE1-GFP fusions may lead to mislocalization, aggregation, or ER stress. Use endogenous promoters or controlled expression systems.

  • Fixation artifacts: Chemical fixation for immunofluorescence can alter membrane structures. Compare live cell imaging with fixed preparations when possible.

  • Resolution limitations: Standard fluorescence microscopy may not resolve fine details of ARE1 distribution within the ER. Consider super-resolution techniques for detailed studies.

  • Single time-point bias: ARE1 localization may change under different conditions or during the cell cycle. Examine multiple time points and conditions.

  • Inadequate controls: Always include appropriate markers for cellular compartments, especially ER markers, to confirm colocalization.

  • Background fluorescence: Especially problematic in yeast due to vacuolar autofluorescence. Use appropriate filters and controls to distinguish specific signal from background.

  • Overlooking dynamic behaviors: ARE1 may exhibit dynamic movements or redistributions that static imaging would miss. Consider live-cell time-lapse imaging for complete characterization.

By addressing these potential issues in experimental design and being cautious in interpretation, researchers can obtain more reliable insights into the authentic subcellular localization and dynamics of ARE1.

What are promising approaches for engineering ARE1 with altered substrate specificity?

Engineering ARE1 with altered substrate specificity represents an exciting frontier for both fundamental understanding of enzyme function and biotechnological applications. Several promising approaches include:

  • Structure-guided mutagenesis: Though the crystal structure of ARE1 is not yet available, homology modeling based on related enzymes can guide targeted mutations in putative substrate-binding regions.

  • Directed evolution: Developing high-throughput screens or selections for ARE1 variants with desired activities could allow exploration of a larger sequence space than rational design alone.

  • Domain swapping: Creating chimeric proteins between ARE1 and ARE2 or more distantly related acyltransferases may generate enzymes with novel specificities.

  • Computational design: In silico screening of enzyme variants for binding to target substrates can prioritize candidates for experimental validation.

  • Ancestral sequence reconstruction: Reconstructing and characterizing ancestral forms of ARE1/ARE2 before their functional divergence may provide insights into the evolutionary trajectory of substrate specificity.

These approaches could lead to ARE1 variants capable of esterifying non-native sterols or even non-sterol substrates, expanding the toolkit for lipid engineering in yeast and other systems. The natural substrate promiscuity of ARE1 relative to ARE2 suggests it may be more amenable to engineering for novel activities .

How might the recombination hotspot at ARE1 influence experimental design?

The presence of a recombination hotspot at the ARE1 locus has important implications for experimental design, particularly in studies involving genetic manipulation of this region:

  • Increased recombination frequency: The ARE1 locus experiences higher rates of recombination, which could affect the stability of genetic constructs integrated at or near this site .

  • Implications for integration site choice: Researchers planning to integrate expression cassettes or reporter constructs should consider the potential impact of the hotspot on construct stability and potential unwanted recombination events.

  • Opportunities for recombination studies: The ARE1 hotspot provides an excellent model system for studying recombination mechanisms and regulation in yeast.

  • Population genetic considerations: Studies of natural variation in ARE1 should account for the effects of recombination on linkage disequilibrium patterns in this region.

  • Potential for accelerated evolution: The high recombination rate at this locus may facilitate more rapid evolution of ARE1 variants in experimental evolution studies.

For researchers directly studying ARE1 function, awareness of this recombination hotspot is crucial when designing genetic manipulations, interpreting inheritance patterns, and analyzing evolutionary data related to this locus.

What is the evolutionary significance of ARE1/ARE2 functional divergence?

The functional divergence between ARE1 and ARE2 presents an intriguing case study in enzyme evolution and specialization. Several evolutionary aspects warrant further investigation:

  • Selective pressures: What selective pressures drove the functional divergence of these paralogs after gene duplication? The preference of ARE1 for sterol precursors versus ARE2's preference for ergosterol suggests adaptation to different aspects of sterol metabolism .

  • Conservation across fungal species: Examining the conservation of ARE1/ARE2 orthologs across diverse fungal lineages could reveal whether this functional divergence is widespread or specific to certain taxonomic groups.

  • Correlation with ecological niches: Do species from different ecological niches show variations in ARE1/ARE2 function that correlate with environmental factors affecting sterol metabolism?

  • Coevolution with sterol biosynthesis pathways: Has the evolution of ARE1/ARE2 been influenced by changes in the sterol biosynthesis pathway across fungal evolution?

  • Implications for antifungal resistance: The role of these enzymes in sterol homeostasis may have implications for fungal adaptation to antifungal compounds targeting sterol biosynthesis, as suggested by the increased sensitivity of are1are2 mutants to terbinafine .

Understanding these evolutionary questions could provide insights not only into the specific functions of ARE1 and ARE2 but also into broader principles of enzyme evolution following gene duplication and the adaptive significance of metabolic pathway specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.