Recombinant Saccharomyces cerevisiae Sterol O-acyltransferase 2 (ARE2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Sterol Metabolism

ARE2 is the primary enzyme responsible for sterol esterification in S. cerevisiae, contributing ~75% of total steryl ester synthesis under aerobic conditions . Its roles include:

Esterification of Ergosterol

ARE2 catalyzes the transfer of acyl-CoA to ergosterol, forming steryl esters stored in lipid droplets . This process regulates membrane sterol levels and prevents cellular toxicity from free ergosterol accumulation .

Regulation of Sterol Homeostasis

FactorEffect on ARE2
Heme AvailabilityDownregulated under heme deficiency; inversely regulated compared to ARE1
HAP1 Transcription FactorRequired for optimal expression; binds to ARE2 promoter under aerobic conditions
Oxygen LevelsDerepressed in rox1 mutants (oxygen-insensitive regulatory pathway)

ARE2 is not subject to end-product inhibition, allowing sustained esterification even when sterol levels are high .

Comparative Analysis with ARE1

ARE2 and ARE1 exhibit distinct substrate preferences and regulatory profiles:

ParameterARE2ARE1
Primary SubstrateErgosterol (end-product sterol)Sterol intermediates (e.g., lanosterol)
Transcription RateHigher promoter activity Lower promoter activity
mRNA Stability~12x longer half-life Shorter transcript stability
Heme RegulationRepressed under heme deficiencyUpregulated under heme deficiency

Ergosterol Production

Overexpression of ARE2 in S. cerevisiae significantly enhances ergosterol yield:

Strain ModificationErgosterol Content (mg/g DCW)Source
Wild-type (S1)7.8
S1-ARE2 (overexpressing ARE2)10.0
S1-ARE2 + UPC2-116.7
S1-ARE2 + UPC2-1 + ACC120.7

Combining ARE2 overexpression with dynamic promoter systems and fatty acid synthesis optimization achieved 40.6 mg/g DCW ergosterol, a 4.2-fold increase over wild-type .

Industrial Fermentation

A two-stage feeding strategy with engineered strains yielded 2,986.7 mg/L ergosterol, demonstrating scalability for commercial production .

Substrate Preference

Overexpression of ARE2 in are1Δare2Δ mutants revealed:

  • Ester fraction composition:

    • Ergosterol: 38.7%

    • Sterol intermediates (e.g., lanosterol, zymosterol): <15%

  • Free sterol composition:

    • Ergosterol: 74.7%

    • Intermediates: <25%

Growth Implications

are1Δare2Δ mutants exhibit:

  • Increased sensitivity to terbinafine (ergosterol biosynthesis inhibitor) .

  • Reduced growth rates in competitive environments due to steryl ester deficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ARE2; SAT1; YNR019W; N3206; Sterol O-acyltransferase 2; Sterol-ester synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-642
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ARE2
Target Protein Sequence
MDKKKDLLENEQFLRIQKLNAADAGKRQSITVDDEGELYGLDTSGNSPANEHTATTITQN HSVVASNGDVAFIPGTATEGNTEIVTEEVIETDDNMFKTHVKTLSSKEKARYRQGSSNFI SYFDDMSFEHRPSILDGSVNEPFKTKFVGPTLEKEIRRREKELMAMRKNLHHRKSSPDAV DSVGKNDGAAPTTVPTAATSETVVTVETTIISSNFSGLYVAFWMAIAFGAVKALIDYYYQ HNGSFKDSEILKFMTTNLFTVASVDLLMYLSTYFVVGIQYLCKWGVLKWGTTGWIFTSIY EFLFVIFYMYLTENILKLHWLSKIFLFLHSLVLLMKMHSFAFYNGYLWGIKEELQFSKSA LAKYKDSINDPKVIGALEKSCEFCSFELSSQSLSDQTQKFPNNISAKSFFWFTMFPTLIY QIEYPRTKEIRWSYVLEKICAIFGTIFLMMIDAQILMYPVAMRALAVRNSEWTGILDRLL KWVGLLVDIVPGFIVMYILDFYLIWDAILNCVAELTRFGDRYFYGDWWNCVSWADFSRIW NIPVHKFLLRHVYHSSMSSFKLNKSQATLMTFFLSSVVHELAMYVIFKKLRFYLFFFQML QMPLVALTNTKFMRNRTIIGNVIFWLGICMGPSVMCTLYLTF
Uniprot No.

Target Background

Function

Sterol O-acyltransferase catalyzes the formation of steryl esters.

Database Links

KEGG: sce:YNR019W

STRING: 4932.YNR019W

Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Sterol O-acyltransferase 2 (Are2p) in Saccharomyces cerevisiae and what is its primary function?

The primary function of Are2p is maintaining sterol homeostasis in the cell by converting excess free sterols into steryl esters, which serve as storage forms of sterols. This process is crucial for membrane integrity and function, as well as for regulating cellular sterol levels .

Where is Are2p localized within the yeast cell and how has this been determined experimentally?

Are2p is localized to the endoplasmic reticulum (ER) membrane in S. cerevisiae. This subcellular localization has been experimentally determined through:

  • Subcellular fractionation: ASAT activity measurements in different cellular fractions of are1 and are2 deletion strains demonstrated that the enzymatic activity was primarily associated with ER-enriched fractions.

  • Fluorescence microscopy: The localization was confirmed using hybrid proteins where Are2p was fused to green fluorescent protein (GFP). The fluorescence pattern observed corresponded to the characteristic ER distribution in yeast cells .

This ER localization is consistent with the protein's function in lipid metabolism, as the ER is a major site for lipid biosynthesis and steryl ester formation in eukaryotic cells.

How do Are2p and Are1p differ in substrate specificity?

Are2p and Are1p exhibit different substrate preferences despite catalyzing the same reaction:

EnzymePreferred Sterol SubstratesFatty Acid Specificity
Are2pStrong preference for ergosterol (mature sterol)Similar specificity as Are1p
Are1pEsterifies sterol precursors (primarily lanosterol) and ergosterolSimilar specificity as Are2p

The differential substrate specificity suggests that Are2p mainly functions in storing excess mature sterols (ergosterol), while Are1p may play a role in regulating the levels of sterol intermediates in the ergosterol biosynthetic pathway. This functional differentiation allows the cell to regulate both end-product sterols and biosynthetic intermediates through esterification .

What are the most effective methods for expressing recombinant Are2p in yeast expression systems?

Effective methods for expressing recombinant Are2p in yeast include:

  • Genomic integration approach:

    • Design expression cassettes containing the ARE2 gene under the control of a constitutive promoter like GAPDH (glyceraldehyde-3-phosphate dehydrogenase).

    • Include appropriate targeting sequences for chromosomal integration.

    • Use selection markers (e.g., auxotrophic markers like LEU2) to identify successful transformants.

    • Validate integration through PCR analysis of genomic DNA using specific primers flanking the integration site .

  • Surface display system:

    • Fuse ARE2 to cell wall anchoring domains like Aga2p, which allows display of the protein on the cell surface.

    • Include epitope tags (e.g., 6×His-tag) at the C-terminus for detection and purification.

    • Verify surface expression using immunofluorescence assays with tagged antibodies .

  • Expression validation:

    • Confirm protein expression through Western blotting using antibodies against epitope tags.

    • Assess enzyme activity through in vitro ASAT assays using different sterol substrates and acyl-CoA donors.

    • Quantify expression levels through RT-qPCR analysis of mRNA transcripts .

How can researchers effectively create and validate ARE2 knockout strains?

Creating and validating ARE2 knockout strains requires:

  • Knockout construction:

    • Design deletion cassettes containing a selectable marker (e.g., antibiotic resistance or auxotrophic marker) flanked by homologous sequences to the ARE2 gene.

    • Transform the deletion cassette into yeast cells, where homologous recombination will replace the ARE2 gene with the marker.

    • For complete functional analysis, consider creating single are1Δ, are2Δ, and double are1Δare2Δ knockout strains to assess compensatory mechanisms .

  • Validation strategies:

    • PCR verification: Design primers that anneal outside the deletion region to confirm correct integration of the knockout cassette.

    • Southern blotting: Verify the absence of ARE2 gene and correct integration at the genomic level.

    • Enzymatic assays: Measure ASAT activity using ergosterol as substrate to confirm functional deletion.

    • Lipid profiling: Analyze steryl ester composition, which should show altered profiles in knockout strains .

  • Phenotypic characterization:

    • Growth rate analysis in standard and stress conditions.

    • Microscopic examination for morphological changes.

    • Lipid droplet staining (with Nile Red or BODIPY) to assess changes in neutral lipid storage.

    • Sterol profiling to quantify free sterols versus esterified sterols .

What analytical techniques are most suitable for quantifying steryl ester formation by Are2p?

The most suitable analytical techniques for quantifying steryl ester formation include:

  • Thin Layer Chromatography (TLC):

    • Extract total lipids from yeast cells using chloroform/methanol extraction.

    • Separate lipid classes on silica gel plates using appropriate solvent systems.

    • Visualize and quantify steryl esters using charring reagents or specific dyes.

    • Suitable for comparative analysis but less precise for absolute quantification.

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • Provides accurate identification and quantification of individual steryl ester species.

    • Requires derivatization of samples to increase volatility.

    • Can identify both the sterol and fatty acid components of steryl esters.

    • Offers high sensitivity and reproducibility for detailed compositional analysis.

  • High-Performance Liquid Chromatography (HPLC):

    • Can separate different steryl ester species based on their hydrophobicity.

    • When coupled with evaporative light scattering detection (ELSD) or mass spectrometry, provides sensitive detection of steryl esters.

    • Less destructive than GC-MS and does not require derivatization.

  • Enzymatic assays:

    • In vitro assays using purified or membrane-bound Are2p.

    • Incorporate radioactive or fluorescently labeled substrates (sterols or acyl-CoA).

    • Measure formation of labeled steryl esters over time.

    • Allow direct assessment of enzyme kinetics and substrate specificity .

How is the expression of ARE2 regulated in response to different environmental conditions?

The expression of ARE2 is regulated by multiple factors:

  • Oxygen levels:

    • Under aerobic conditions, ARE2 expression is higher than ARE1.

    • Under anaerobic conditions, there is a shift towards increased ARE1 expression relative to ARE2, as ergosterol biosynthesis requires oxygen.

  • Sterol availability:

    • High levels of ergosterol can increase ARE2 expression to promote steryl ester formation and storage.

    • Sterol regulatory element binding proteins (SREBPs) likely mediate this response.

  • Growth phase:

    • ARE2 expression typically increases during late logarithmic and stationary phases when excess sterols need to be stored.

    • This regulation helps prepare cells for periods of nutrient limitation.

  • Stress conditions:

    • Certain cellular stresses, such as heat shock or oxidative stress, can alter ARE2 expression.

    • The stress response may be mediated through general stress response elements in the ARE2 promoter.

  • Nutrient availability:

    • Carbon source affects the expression pattern, with glucose repression potentially playing a role in ARE2 regulation.

    • Nitrogen limitation may increase steryl ester formation as part of the general stress response .

What are the phenotypic consequences of ARE2 deletion compared to ARE1 deletion in yeast?

The phenotypic consequences of ARE1 and ARE2 deletions reveal their distinct roles:

Phenotypic Aspectare1Δare2Δare1Δare2Δ (double mutant)
Growth rate (standard conditions)Similar to wild-typeSimilar to wild-typeSimilar to wild-type
Steryl ester contentModest reductionSubstantial reductionComplete absence
Free sterol levelsSlightly increasedModerately increasedSignificantly increased
Sterol compositionNear normalAltered ratiosAltered with increased precursors
Stress sensitivityMinorModerateEnhanced sensitivity to ergosterol biosynthesis inhibitors
Long-term competitive fitnessNear normalSlightly reducedReduced in extended cultivation

These phenotypic differences indicate that:

  • Are2p plays the predominant role in steryl ester synthesis under standard growth conditions.

  • Neither enzyme is essential for viability under laboratory conditions.

  • Cells can compensate for the loss of steryl ester formation by increasing free sterol levels.

  • The lack of steryl esters becomes more detrimental under specific stress conditions or in natural environments .

How do Are1p and Are2p interact with other components of lipid metabolism pathways?

Are1p and Are2p interact with various components of lipid metabolism through:

  • Sterol biosynthetic pathway integration:

    • Are2p preferentially esterifies ergosterol (end product of sterol synthesis).

    • Are1p can esterify lanosterol and other intermediates in the ergosterol biosynthetic pathway.

    • This creates a regulatory network where esterification affects the flow through the sterol synthesis pathway.

  • Lipid droplet biogenesis:

    • Steryl esters produced by Are1p and Are2p, along with triacylglycerols, form the core of lipid droplets.

    • Interactions with lipid droplet proteins (e.g., Erg6p, Tgl1p) coordinate storage and mobilization of neutral lipids.

  • Membrane homeostasis:

    • Are2p activity affects free ergosterol availability for membrane incorporation.

    • Coordination with phospholipid synthesis enzymes maintains proper membrane sterol:phospholipid ratios.

  • Regulatory cross-talk:

    • Transcriptional regulators like Upc2p may coordinate expression of both sterol biosynthetic genes and ARE1/ARE2.

    • The enzymes likely respond to the same lipid sensors that regulate other aspects of lipid metabolism.

  • Stress response pathways:

    • Under terbinafine treatment (an ergosterol biosynthesis inhibitor), are1Δare2Δ cells show increased sensitivity.

    • This suggests coordination between steryl ester metabolism and cellular stress response mechanisms .

How can recombinant ARE2 expression systems be optimized for heterologous protein production?

Optimizing recombinant ARE2 expression systems for heterologous protein production involves:

  • Promoter selection:

    • Use strong constitutive promoters (GAPDH, TDH3, PGK1) for high-level expression.

    • Consider inducible promoters (GAL1, CUP1) for controlled expression timing.

    • The GAPDH promoter (667 bp) has been successfully used for expression of heterologous proteins on yeast cell surfaces .

  • Codon optimization:

    • Analyze the codon usage bias of S. cerevisiae and optimize the ARE2 coding sequence accordingly.

    • Codon optimization can significantly improve translation efficiency and protein yields.

    • Commercial services or computational tools can design optimized sequences .

  • Signal sequence and fusion tags:

    • Include appropriate signal sequences for targeted localization (ER retention signal for Are2p).

    • Add epitope tags (His, FLAG, HA) for detection and purification.

    • Consider fusion with well-expressed yeast proteins (e.g., Aga2p) to enhance expression and stability .

  • Genomic integration strategies:

    • Multiple integration events can increase copy number and expression levels.

    • Target integration to chromosomal regions with high transcriptional activity.

    • Utilize ARS (Autonomously Replicating Sequence) elements nearby to enhance expression, as demonstrated in heterologous gene expression studies .

  • Host strain optimization:

    • Use protease-deficient strains to minimize protein degradation.

    • Consider strains with altered sterol metabolism for studying Are2p function.

    • Deletion of competing pathways can channel metabolic flux toward the desired product .

What are the current challenges in studying Are2p structure-function relationships?

Current challenges in Are2p structure-function studies include:

  • Membrane protein crystallization:

    • As an ER membrane protein, Are2p is difficult to crystallize for X-ray crystallography.

    • Detergent selection, protein stability, and crystal formation represent significant hurdles.

    • Alternative approaches like cryo-electron microscopy may be more suitable but still challenging.

  • Active site characterization:

    • Identifying catalytic residues and substrate binding sites remains incomplete.

    • Mutagenesis studies are complicated by potential effects on protein folding and stability.

    • The lack of high-resolution structural information hinders rational design of mutations.

  • Substrate specificity determinants:

    • The molecular basis for Are2p's preference for ergosterol over sterol precursors is not fully understood.

    • Chimeric protein studies between Are1p and Are2p could help identify domains responsible for substrate specificity.

  • Protein-protein interactions:

    • Identifying interaction partners in the ER membrane is technically challenging.

    • Crosslinking approaches and proximity labeling may help identify these interactions.

    • Understanding how Are2p integrates into larger metabolic complexes remains uncertain.

  • Post-translational modifications:

    • The role of potential post-translational modifications in regulating Are2p activity is poorly characterized.

    • Identifying these modifications and their functional consequences requires specialized proteomics approaches.

How do changes in sterol composition affect Are2p activity in genetic models of sterol metabolism disorders?

In genetic models of sterol metabolism disorders, Are2p activity is affected by altered sterol composition in several ways:

  • Substrate availability effects:

    • Mutations in ergosterol biosynthetic genes (ERG genes) lead to accumulation of sterol intermediates.

    • Are2p shows lower activity toward these intermediates compared to Are1p.

    • This can result in redistribution of esterification activity between Are1p and Are2p.

  • Feedback regulation:

    • Abnormal sterol profiles may trigger compensatory changes in ARE2 expression.

    • Altered sterol composition can affect the membrane environment where Are2p functions.

    • This may lead to changes in enzyme conformation, stability, or activity.

  • Stress response integration:

    • Sterol metabolism disorders often trigger cellular stress responses.

    • These stress pathways may indirectly regulate Are2p activity through post-translational modifications.

    • Growth competition experiments show that are1Δare2Δ cells grow more slowly than wild-type after several rounds of cultivation, suggesting their importance in stress adaptation .

  • Membrane physiology alterations:

    • Changes in sterol composition affect membrane fluidity and organization.

    • This altered membrane environment can affect Are2p activity and substrate accessibility.

    • Compensatory mechanisms try to maintain membrane homeostasis despite altered sterol profiles.

  • Therapeutic implications:

    • Understanding how Are2p responds to altered sterol profiles may reveal potential therapeutic targets.

    • Modulating Are2p activity could potentially alleviate some consequences of sterol metabolism disorders.

    • The terbinafine sensitivity of are1Δare2Δ cells highlights the importance of steryl esters during inhibition of ergosterol biosynthesis .

How have Are1p and Are2p evolved and diverged in function across yeast species?

The evolutionary history and functional divergence of Are1p and Are2p across yeast species reveal important insights:

  • Gene duplication origins:

    • Are1p and Are2p likely arose from an ancient gene duplication event.

    • This duplication allowed subfunctionalization, with each enzyme developing specialized roles while maintaining overlapping functions.

    • The timing of this duplication appears to coincide with the whole genome duplication event in the Saccharomycetaceae lineage.

  • Functional conservation and divergence:

    • The substrate preference of Are2p for mature sterols appears conserved across various yeast species.

    • Are1p's ability to esterify sterol precursors varies more significantly between species.

    • The degree of functional overlap between the two enzymes differs across the yeast phylogeny.

  • Transcriptional regulation evolution:

    • Regulatory elements controlling ARE1 and ARE2 expression show varying degrees of conservation.

    • Some species exhibit differential regulation in response to oxygen, while others show more constitutive expression patterns.

    • This suggests adaptation to different ecological niches and metabolic demands.

  • Structural conservation:

    • Key catalytic domains are highly conserved across species.

    • Transmembrane domains show higher variation, potentially reflecting adaptation to different membrane environments.

    • Comparative analysis can help identify essential versus adaptable regions of the proteins.

What can comparative genomics tell us about the substrate specificity differences between Are1p and Are2p?

Comparative genomics provides valuable insights into the substrate specificity differences between Are1p and Are2p:

How does the function of Are2p in S. cerevisiae compare to similar enzymes in other organisms including humans?

The function of Are2p in S. cerevisiae compared to similar enzymes in other organisms reveals important evolutionary relationships and potential biomedical implications:

  • Mammalian orthologs:

    • The mammalian acyl-CoA:cholesterol acyltransferases (ACAT1 and ACAT2) are functional analogs of yeast Are1p and Are2p.

    • ACAT1 is expressed in most tissues, while ACAT2 is primarily expressed in intestines and liver.

    • This parallel specialization suggests convergent evolution of tissue-specific roles.

  • Substrate specificity comparison:

    • Are2p preferentially esterifies ergosterol, the main yeast sterol.

    • Mammalian ACATs esterify cholesterol, the predominant sterol in mammals.

    • Plant sterol acyltransferases handle a wider range of phytosterols.

    • These specificity differences reflect adaptation to the distinctive sterol profiles of each organism.

  • Cellular localization:

    • Are2p is located in the ER membrane in yeast.

    • ACAT1 is found in various cellular compartments, while ACAT2 is primarily in the ER.

    • This conserved ER localization for at least one isoform highlights the importance of this compartment for sterol esterification across species.

  • Physiological roles:

    • In yeast, Are2p primarily functions in sterol storage and homeostasis.

    • In mammals, ACAT enzymes play critical roles in atherosclerosis, cholesterol absorption, and steroidogenesis.

    • In plants, sterol acyltransferases contribute to membrane composition and stress responses.

    • These diverse roles demonstrate how similar enzymatic functions have been adapted to different physiological contexts.

  • Biomedical relevance:

    • S. cerevisiae Are2p serves as a useful model for understanding human ACAT function.

    • Inhibitors designed against yeast Are2p may provide templates for human ACAT inhibitors with potential applications in treating atherosclerosis.

    • The simpler yeast system facilitates mechanistic studies that are more challenging in mammalian cells .

What are the most promising applications of engineered Are2p in biotechnology?

Several promising applications of engineered Are2p in biotechnology include:

  • Biofuel production optimization:

    • Engineered Are2p variants could enhance the storage of fatty acids as steryl esters.

    • This could increase lipid yield in biofuel production strains.

    • Coupling Are2p engineering with fatty acid biosynthesis optimization could create more efficient biofuel-producing yeast strains.

  • Pharmaceutical steroid production:

    • Modified Are2p enzymes could be used for selective esterification of steroid intermediates.

    • This could facilitate purification of specific steroids used in pharmaceutical manufacturing.

    • Controlled esterification and de-esterification could provide new routes for steroid modification.

  • Nutraceutical development:

    • Engineered Are2p could help produce esterified phytosterols with enhanced bioavailability.

    • These modified sterols may have applications in functional foods for cholesterol management.

    • Yeast strains with optimized Are2p could serve as production platforms for these compounds.

  • Biosensors for sterol levels:

    • Are2p-based biosensors could detect specific sterols in biological samples.

    • Coupling Are2p activity to reporter systems could create diagnostic tools.

    • Such biosensors might have applications in monitoring sterol metabolism disorders.

  • Model system for drug development:

    • Yeast expressing human ACAT variants and Are2p can serve as screening platforms for ACAT inhibitors.

    • This approach could accelerate the discovery of drugs targeting disorders of cholesterol metabolism.

    • The relatively simple yeast system allows rapid testing of hypotheses about sterol esterification mechanisms.

What key questions remain unresolved in our understanding of Are2p function and regulation?

Despite significant advances, several key questions about Are2p remain unresolved:

  • Structural determinants of function:

    • What is the three-dimensional structure of Are2p, and how does it accommodate its substrates?

    • Which specific residues determine the preference for ergosterol over sterol precursors?

    • How do the transmembrane domains contribute to enzyme function and stability?

  • Regulatory mechanisms:

    • What are the precise transcriptional regulatory elements controlling ARE2 expression?

    • How is Are2p activity post-translationally regulated in response to changing cellular conditions?

    • What protein-protein interactions modulate Are2p function in vivo?

  • Metabolic integration:

    • How is Are2p activity coordinated with other aspects of lipid metabolism?

    • What signaling pathways respond to changes in steryl ester levels?

    • How do cells sense the appropriate balance between free and esterified sterols?

  • Physiological significance:

    • Why do are1Δare2Δ double mutants show reduced fitness in natural environments despite growing normally in laboratory conditions?

    • What specific stress conditions most strongly require functional steryl ester synthesis?

    • How does steryl ester metabolism contribute to yeast adaptation and evolution?

  • Technological limitations:

    • How can we better study membrane protein dynamics and interactions in the native ER environment?

    • What methodologies could improve our ability to manipulate and analyze steryl ester pools in living cells?

    • How can we develop better tools for visualizing and quantifying steryl ester metabolism in real time?

How might synthetic biology approaches advance our ability to engineer Are2p for novel functions?

Synthetic biology approaches offer powerful strategies for engineering Are2p for novel functions:

  • Directed evolution platforms:

    • High-throughput screening systems linking Are2p activity to selectable phenotypes.

    • Error-prone PCR and DNA shuffling to generate diverse Are2p variants.

    • Continuous evolution systems that couple Are2p function to yeast survival or growth.

    • These approaches could yield Are2p variants with altered substrate specificity or enhanced activity.

  • Domain swapping and chimeric enzymes:

    • Creating Are1p/Are2p chimeras to identify domains controlling substrate specificity.

    • Incorporating domains from mammalian ACAT enzymes to create hybrid enzymes with novel properties.

    • Rational design of fusion proteins combining Are2p with other enzymes in sterol metabolism.

    • These approaches could generate multi-functional enzymes that catalyze sequential reactions.

  • Computational design:

    • Homology modeling and molecular dynamics simulations to predict structural modifications.

    • In silico screening of potential mutations to enhance specific properties.

    • Machine learning approaches to identify non-obvious sequence-function relationships.

    • These computational tools could guide experimental design and accelerate optimization.

  • Genome-scale engineering:

    • Integration with other metabolic engineering approaches to optimize entire pathways.

    • Using CRISPR-Cas9 for precise genomic modifications affecting Are2p expression and function.

    • Multiplex genome engineering to simultaneously optimize Are2p and related enzymes.

    • These approaches could yield strains with comprehensively optimized sterol metabolism .

  • Cell-free systems:

    • Reconstituting Are2p function in synthetic membrane systems.

    • Creating minimal systems to study Are2p without cellular complexity.

    • Engineering artificial cells with defined steryl ester metabolism.

    • These approaches could provide fundamental insights into Are2p function and facilitate industrial applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.