Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDH4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
SDH4; ACN18; YDR178W; YD9395.11; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-181
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SDH4
Target Protein Sequence
LTIPFLPVLPQKPGGVRGTPNDAYVPPPENKLEGSYHWYMEKIFALSVVPLATTAMLTTG PLSTAADSFFSVMLLGYCYMEFNSCITDYISERVYGVWHKYAMYMLGLGSAVSLFGIYKL ETENDGVVGLVKSLWDSSEKDNSQKIEAKK
Uniprot No.

Target Background

Function

This protein is the membrane-anchoring subunit of succinate dehydrogenase (SDH), a critical component of mitochondrial complex II in the electron transport chain. Its function involves transferring electrons from succinate to ubiquinone (coenzyme Q). SDH3 and SDH4 form a membrane-bound dimer that anchors the catalytic dimer (SDH1 and SDH2) to the inner mitochondrial membrane's matrix side. Electrons from the catalytic dimer are then passed to the membrane dimer for ubiquinone reduction.

Gene References Into Functions
  1. Alternative SDH subunits have been identified in the Saccharomyces cerevisiae genome, including a paralog of the Sdh3p subunit (Shh3p, YMR118c) and two paralogs of the Sdh4p subunit (Shh4p, YLR164w) and Tim18p (YOR297c). PMID: 22573324
  2. Research illuminates the metabolic consequences of SDH3 and SDH4 dysfunction, highlighting the utility of metabolic footprinting in studying complex disorders like mitochondrial diseases. PMID: 20964315
  3. Findings support a role for Tyr-89 in ubiquinone protonation and suggest that reactive oxygen species generation is not the primary cause of tumor formation. PMID: 17208193
Database Links

KEGG: sce:YDR178W

STRING: 4932.YDR178W

Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of SDH4 in Saccharomyces cerevisiae?

SDH4 encodes the small membrane subunit of succinate dehydrogenase (SDH), a critical enzyme in both the Krebs cycle and the respiratory chain. Structurally, SDH comprises two domains: a catalytic, membrane-extrinsic domain containing Sdh1p and Sdh2p subunits, and a membrane domain containing Sdh3p and Sdh4p subunits. The Sdh4p protein contains three transmembrane helices with its amino terminus located in the mitochondrial matrix. The Sdh3p and Sdh4p subunits together form the proximal quinone-binding site, allowing electrons to transfer from succinate to ubiquinone. Importantly, several key residues in Sdh4p, including Asp-119 and Tyr-120, participate directly in this proximal quinone-binding site, while Cys-109 serves as an axial ligand for the b-type heme found in the membrane domain .

How can researchers clone and express recombinant SDH4 in yeast systems?

To clone and express recombinant SDH4, researchers should employ a systematic approach beginning with gene isolation. The SDH4 gene should be PCR-amplified using specific primers designed to include appropriate restriction sites for subsequent cloning. For optimal expression in yeast, the gene can be cloned into either single or multicopy vectors containing strong promoters such as GAL1 or constitutive promoters like PGK1 or TDH3, depending on the desired expression level.

Transformation into the appropriate yeast strain is crucial - researchers typically use strains lacking endogenous SDH4 (Δsdh4) to prevent interference from the native protein. Transformation can be performed using the lithium acetate method, selecting transformants on media lacking the appropriate auxotrophic marker . Expression should be verified using Western blot analysis with antibodies specific to Sdh4p or to an epitope tag if one was incorporated into the construct. For functional studies, confirm respiratory competence by assessing growth on non-fermentable carbon sources such as glycerol or ethanol .

What are the homologs of SDH4 in S. cerevisiae and how do they differ functionally?

S. cerevisiae contains two significant homologs of Sdh4p: Shh4p (YLR164w) and Tim18p (YOR297c). These proteins share considerable sequence identity with Sdh4p, with Shh4p being 52% identical (74% similar) and Tim18p being 36% identical (57% similar) to Sdh4p .

Structural comparisons reveal that both homologs contain three predicted transmembrane helices and mitochondrial targeting sequences. While Shh4p preserves key functional residues found in Sdh4p, including Phe-100, Ser-102, and Lys-163 (proposed to form part of a distal quinone-binding site), as well as Cys-109 (the heme axial ligand), Tim18p retains only some of these residues. Both Shh4p and Tim18p conserve the Asp-119 and Tyr-120 residues that participate in the proximal quinone-binding site .

Functionally, Shh4p can support respiratory growth when expressed in place of Sdh4p. Expression studies demonstrate that Shh4p-containing hybrid SDH enzymes retain significant catalytic activity (73% of wild-type for DCPIP reductase activity). In contrast, Tim18p functions primarily as a component of the TIM22 mitochondrial inner membrane import complex, mediating the import of membrane proteins lacking cleavable presequences, and does not appear to participate directly in respiratory functions despite its sequence similarity to Sdh4p .

ProteinSequence Identity to Sdh4pSequence Similarity to Sdh4pFunctional Role
Sdh4p100%100%SDH membrane subunit
Shh4p52%74%Alternative SDH subunit
Tim18p36%57%TIM22 import complex

How can SDH4 expression be detected and quantified in yeast cells?

Detection and quantification of SDH4 expression can be accomplished through multiple complementary techniques. For protein-level detection, western blotting using specific antibodies against Sdh4p provides direct evidence of expression. If antibodies are unavailable or lack specificity, researchers can epitope-tag the Sdh4p (typically with HA, Myc, or FLAG tags) at either the N- or C-terminus, ensuring the tag doesn't interfere with protein function or localization .

For functional quantification, researchers can measure several SDH activities in isolated mitochondria. The succinate-dependent, PMS-mediated DCPIP reductase activity provides a measure of the membrane-associated catalytic dimer assembly, while cytochrome c and 2,6-dichlorophenolindophenol (DB) reductase activities both require a functional membrane domain . Additionally, researchers can measure the amount of covalent FAD in mitochondrial preparations as an indirect measure of assembled SDH levels, since SDH is the major covalent flavoprotein in S. cerevisiae .

The mRNA expression levels can be quantified using RT-qPCR or RNA-Seq. Expression correlation analysis with other SDH subunits across different conditions can provide insights into co-regulation patterns. For instance, SDH1, SDH2, SDH3, and SDH4 genes typically show highly correlated expression patterns (Pearson coefficients >0.8) under conditions such as glucose limitation and the fermentative to glycerol transition .

What experimental approaches can be used to study the interaction between SDH4 and other SDH subunits?

Studying interactions between Sdh4p and other SDH subunits requires sophisticated biochemical and genetic approaches. Co-immunoprecipitation (co-IP) represents a foundational method where antibodies against one subunit can pull down the entire complex, allowing identification of interacting partners by western blot or mass spectrometry. This approach has been successfully used to demonstrate that Tim18p, though similar to Sdh4p, does not physically associate with SDH subunits but rather with Tim54p, Tim22p, and Tim12p components of the import machinery .

Yeast two-hybrid (Y2H) analysis can identify direct protein-protein interactions, though membrane proteins like Sdh4p present challenges that can be overcome by using split-ubiquitin Y2H systems specifically designed for membrane proteins. Genetic approaches such as synthetic lethality screens can identify functional interactions - for example, disruption of TIM18 is synthetic lethal with tim54(ts), tim9(ts), and tim10(ts) mutations, confirming functional relationships .

For structural studies of assembled complexes, Blue Native PAGE separates intact respiratory complexes and can be combined with antibody detection or activity staining to identify SDH. More detailed structural information can be obtained through cryo-electron microscopy or X-ray crystallography, though these require highly purified protein complexes.

Crosslinking studies using agents like DSP (dithiobis[succinimidylpropionate]) can "freeze" transient interactions for subsequent analysis. Finally, fluorescence resonance energy transfer (FRET) using fluorescently tagged SDH subunits can provide information about proximity and interactions in living cells .

How can researchers create hybrid SDH enzymes with SDH4 homologs and assess their functionality?

Creating functional hybrid SDH enzymes with SDH4 homologs requires a methodical genetic engineering approach. Begin by cloning the homolog genes (SHH3, SHH4, TIM18) into appropriate expression vectors. Both single and multicopy vectors should be considered, as expression levels may affect complementation efficiency. These constructs should then be transformed into strains lacking the native SDH subunits (Δsdh3, Δsdh4, or Δsdh3Δsdh4 double knockouts) .

To rigorously assess functionality of these hybrid enzymes, a multi-tiered analytical approach is essential:

  • Growth phenotype analysis: Test transformants for respiratory competence by evaluating growth on non-fermentable carbon sources like glycerol or ethanol. Quantitative growth curve analysis provides more precise measurements than simple spot assays .

  • Enzyme activity measurements: Multiple complementary assays should be performed:

    • Succinate-dependent, PMS-mediated DCPIP reductase activity measures membrane association of the catalytic dimer

    • Cytochrome c reductase activity assesses electron transfer capability

    • DB reductase activity evaluates the functionality of the membrane domain

    • Covalent FAD quantification serves as a measure of assembled SDH

Enzyme CompositionDCPIP Reductase Activity (% of WT)Cytochrome c Reductase Activity (% of WT)DB Reductase Activity (% of WT)
Sdh3p + Sdh4p100100100
Sdh3p + Shh4p733023
Shh3p + Sdh4p1006457
Shh3p + Shh4p716049

What are the implications of SDH4 mutations for understanding human SDH-related diseases?

SDH4 mutations provide crucial insights into human diseases associated with succinate dehydrogenase dysfunction. While mutations in the flavoprotein subunit SDHA typically cause early-onset encephalomyopathy (Leigh syndrome), mutations in the membrane subunits SDHC and SDHD (human homologs of yeast SDH3 and SDH4) are primarily associated with tumor development, particularly paragangliomas and pheochromocytomas .

The yeast system offers powerful advantages for investigating these disease mechanisms. Yeast Sdh4p shares significant structural and functional similarities with human SDHD, allowing researchers to model human mutations in the simpler yeast system. By introducing corresponding human disease-associated mutations into yeast SDH4, researchers can assess their effects on enzyme assembly, stability, catalytic activity, and ROS production .

Key findings from such studies include:

  • Mutations affecting quinone-binding sites in Sdh4p/SDHD can lead to increased production of reactive oxygen species (ROS), potentially explaining the oncogenic mechanism in humans.

  • The unique redox properties of SDH confer specific functions in superoxide handling, suggesting why SDH mutations may cause such diverse clinical presentations ranging from metabolic disorders to cancer predisposition .

  • Yeast studies have revealed that some mutations may primarily affect enzyme stability rather than catalytic function, pointing to potential therapeutic approaches focused on protein stabilization.

These insights demonstrate how yeast SDH4 studies can inform our understanding of human disease mechanisms associated with succinate dehydrogenase deficiencies and potentially guide the development of targeted interventions .

How does the expression of SDH4 and its homologs vary under different metabolic conditions?

The expression patterns of SDH4 and its homologs demonstrate complex regulation across different metabolic conditions. Comprehensive gene expression analysis reveals distinct patterns that provide insights into their physiological roles.

SDH1, SDH2, SDH3, and SDH4 genes show highly correlated expression patterns (Pearson coefficients >0.8) under several specific conditions: glucose limitation, response to environmental changes, and the transition from fermentative to glycerol metabolism. This coordinated expression is logical given their function as components of the same enzyme complex .

The expression profiles of SHH3 and SHH4 exhibit high correlation during peroxisome induction/repression and glucose limitation but show no significant correlation in other datasets. This suggests that these homologs are not consistently co-expressed and may form hybrid SDH complexes only under specific metabolic conditions .

Particularly intriguing is the high correlation between SHH3, SHH4, and SDH1b expression during peroxisome induction and repression, with weaker correlation to SDH2. This pattern suggests the possible assembly of an alternative SDH enzyme (composed of Sdh1bp, Sdh2p, Shh3p, and Shh4p) under conditions where peroxisomal metabolism is active. Since peroxisomes and the glyoxylate cycle generate succinate, this metabolic connection makes biological sense .

ConditionSDH1-4 CorrelationTIM18-SDH4 CorrelationSHH3-SHH4 Correlation
Glucose limitationHigh (>0.8)LowHigh
Environmental changesHigh (>0.8)LowLow
Fermentative to glycerol transitionHigh (>0.8)LowLow
Unfolded protein responseModerateLowLow
SporulationVariableHighLow
Peroxisome induction/repressionVariableLowHigh

What techniques can be used to purify recombinant SDH4 and assess its incorporation into the SDH complex?

Purification of recombinant Sdh4p and assessment of its incorporation into the SDH complex requires specialized techniques due to its membrane-embedded nature. A comprehensive approach involves multiple complementary methods:

For initial enrichment, mitochondria should be isolated from yeast cells using differential centrifugation followed by sucrose gradient purification. The mitochondrial inner membrane fraction, where SDH resides, can then be isolated by osmotic shock and centrifugation. Solubilization of membrane proteins requires careful selection of detergents, with mild non-ionic detergents like digitonin or n-dodecyl-β-D-maltoside (DDM) being preferred to maintain complex integrity .

For purification of intact SDH complex containing the recombinant Sdh4p, affinity chromatography using either antibodies against other SDH subunits or by incorporating an affinity tag (His, FLAG, etc.) on the recombinant Sdh4p is effective. If the tag is placed on Sdh4p, researchers must first verify that the tag doesn't interfere with complex assembly .

To assess incorporation of recombinant Sdh4p into the SDH complex, multiple analytical approaches are necessary:

  • Blue Native PAGE can separate intact respiratory complexes, followed by western blotting to detect Sdh4p or other SDH subunits.

  • Enzyme activity assays, particularly succinate-dependent reduction of artificial electron acceptors like DCPIP, can confirm functional incorporation. More specific assays measuring cytochrome c and DB reductase activities assess the functionality of assembled complexes containing the membrane domain .

  • Spectroscopic analysis can detect b-type heme incorporation, which is dependent on proper integration of Sdh4p with Cys-109 serving as the axial ligand for the heme .

  • Mass spectrometry of purified complexes can identify and quantify the stoichiometry of all components, confirming the presence of recombinant Sdh4p in assembled complexes.

How can researchers investigate the role of specific amino acid residues in SDH4 function through site-directed mutagenesis?

Site-directed mutagenesis of SDH4 provides powerful insights into structure-function relationships within the succinate dehydrogenase complex. To implement this approach effectively, researchers should follow a systematic workflow that begins with careful residue selection based on structural data, sequence conservation, and known functional domains.

Key residues identified in previous research include Asp-119 and Tyr-120 (located in the proximal quinone-binding site), Phe-100, Ser-102, and Lys-163 (potential components of a distal quinone-binding site), and Cys-109 (the axial ligand for heme) . These represent high-priority targets for mutagenesis studies.

The mutagenesis strategy should include:

  • Creating a collection of point mutations using PCR-based methods (QuikChange or overlap extension PCR) in a plasmid containing wild-type SDH4.

  • Designing appropriate substitutions: conservative replacements to test subtle functional requirements, radical changes to completely disrupt function, or substitutions mimicking disease-associated mutations in human SDHD.

  • Transforming mutant constructs into Δsdh4 yeast strains to eliminate interference from wild-type protein.

For comprehensive functional analysis, evaluate each mutant using a multi-tiered approach:

  • Growth phenotype assessment on non-fermentable carbon sources at different temperatures (23°C, 30°C, and 37°C) to detect temperature-sensitive defects .

  • Enzymatic activity measurements using the battery of assays previously described (DCPIP reductase, cytochrome c and DB reductase activities).

  • Complex assembly analysis using Blue Native PAGE followed by western blotting or in-gel activity staining.

  • Spectroscopic analysis to assess heme incorporation, particularly important for mutations affecting Cys-109 .

  • Reactive oxygen species (ROS) measurements to detect potential increases in superoxide production resulting from mutations that disrupt electron transfer .

This integrated approach allows researchers to distinguish between mutations affecting protein stability, complex assembly, catalytic activity, or electron transfer, providing detailed insights into the functional roles of specific residues within Sdh4p.

What strategies can be used to study the expression correlation between SDH4 and its homologs under different conditions?

Investigating expression correlations between SDH4 and its homologs requires a multi-faceted approach combining transcriptomic analyses with functional validation. Researchers should employ both global and targeted methodologies to comprehensively characterize expression patterns across diverse conditions.

For transcriptomic analysis, RNA-Seq provides the most comprehensive view of global expression patterns. Experiments should examine multiple physiologically relevant conditions, including:

  • Transitions between fermentative and respiratory metabolism

  • Glucose limitation

  • Environmental stress responses

  • Peroxisome induction/repression

  • Sporulation

Statistical analysis using Pearson correlation coefficients can identify genes with highly correlated expression patterns. Previous research has shown strong correlations (coefficients >0.8) between SDH1-4 during glucose limitation, environmental response, and fermentative to glycerol transition, while SHH3 and SHH4 show strong correlation specifically during peroxisome induction/repression and glucose limitation .

To validate these correlations at the protein level, researchers should:

  • Generate strains with epitope-tagged versions of Sdh4p, Shh4p, and Tim18p under their native promoters.

  • Perform western blot analysis across the same conditions analyzed in the transcriptomic experiments to confirm that mRNA correlations translate to protein level correlations.

  • Use chromatin immunoprecipitation sequencing (ChIP-seq) to identify shared transcription factors regulating these genes, providing mechanistic insights into their co-regulation.

For functional validation, researchers can create reporter strains where fluorescent proteins are expressed under the control of SDH4, SHH4, and TIM18 promoters, allowing real-time monitoring of expression in living cells across changing conditions. Flow cytometry analysis of these reporter strains can quantify expression levels at the single-cell level, revealing potential heterogeneity in expression that might be masked in population-level analyses .

How can researchers engineer hybrid SDH complexes to optimize enzyme activity for biotechnological applications?

Engineering hybrid SDH complexes with enhanced activity requires a systematic approach that leverages natural variation in SDH subunits and directed evolution techniques. The goal is to create enzymes with improved catalytic efficiency, stability, or altered substrate specificity for biotechnological applications such as biosensors or metabolic engineering.

Initial design strategies should be informed by existing knowledge about SDH4 homologs. Research has demonstrated that hybrid enzymes containing Shh3p and Shh4p retain significant catalytic activity (71% of wild-type for DCPIP reductase activity and 60% and 49% for cytochrome c and DB reductase activities, respectively) . These natural variants provide an excellent starting point for further engineering.

The engineering workflow should include:

  • Creation of a combinatorial library of hybrid SDH complexes by mixing and matching subunits from different sources (Sdh3p/Shh3p with Sdh4p/Shh4p) and incorporating targeted mutations in key functional residues.

  • Development of a high-throughput screening system to rapidly assess enzyme activity. This could involve coupling SDH activity to growth on selective media or to a colorimetric or fluorescent readout.

  • Implementation of directed evolution approaches, including error-prone PCR, DNA shuffling, or CRISPR-based in vivo mutagenesis, to generate and select variants with enhanced properties.

  • Iterative improvement through successive rounds of mutation and selection, potentially incorporating rational design elements based on structural insights.

For industrial applications, additional optimization may focus on:

  • Thermostability improvements to enhance enzyme longevity

  • pH tolerance modifications for diverse operating conditions

  • Substrate specificity alterations for specific biotechnological needs

  • Expression optimization in industrial host organisms

The table below illustrates potential hybrid combinations and their predicted properties based on existing data:

Membrane Domain CompositionPredicted ActivityPotential AdvantagesTarget Applications
Sdh3p + Sdh4p (wild-type)100% (reference)Well-characterizedStandard metabolic engineering
Shh3p + Shh4p~60-70% of wild-typePotentially active under specific metabolic conditionsSpecialized metabolic pathways
Sdh3p(mutant) + Sdh4pVariableTunable electron transferCustom biosensors
Chimeric Sdh3p/Shh3p + Sdh4pPredicted enhancementOptimized domain interactionsHigh-efficiency biocatalysts

Engineering these hybrid complexes not only has biotechnological applications but also provides fundamental insights into the structure-function relationships within the SDH complex .

What are the optimal conditions for expressing recombinant SDH4 in S. cerevisiae?

Optimizing recombinant SDH4 expression in S. cerevisiae requires careful consideration of multiple parameters including strain selection, vector design, and growth conditions. Based on the literature, the following methodological approach is recommended:

Vector design considerations include:

  • Promoter selection: For constitutive expression, strong promoters like PGK1 or TDH3 are recommended. For controlled expression, the GAL1 promoter allows induction with galactose.

  • Copy number: Both single-copy (centromeric) and multi-copy (2μ) vectors have been successfully used. Research indicates that SDH4 and its homologs can complement respiratory growth when expressed from either vector type, though higher expression from multi-copy vectors may be beneficial for protein purification purposes .

  • Selection markers: Standard auxotrophic markers (URA3, LEU2, HIS3, TRP1) or dominant markers (KanMX, HygB) can be used depending on the host strain background.

  • C-terminal or N-terminal tags: If required for detection or purification, ensure they don't interfere with mitochondrial targeting or function.

For growth conditions, the following parameters have been optimized:

  • Media: Rich media such as YP (yeast extract-peptone) supplemented with a non-fermentable carbon source like glycerol (YPG) provides good conditions for respiratory growth and SDH expression .

  • Temperature: Standard growth at 30°C is typically used, though lower temperatures (23-25°C) may improve protein folding and complex assembly.

  • Growth phase: Mid to late logarithmic phase typically yields optimal mitochondrial development and respiratory enzyme expression.

  • Carbon source transitions: Shifting cells from glucose to glycerol or ethanol can enhance expression of respiratory proteins including SDH4 .

Verification of successful expression should combine western blot analysis with functional assays measuring SDH activity in isolated mitochondria, as described in previous sections .

How can researchers effectively disrupt SDH4 gene function to create knockout strains for complementation studies?

Creating effective SDH4 knockout strains requires precision to ensure complete functional disruption while minimizing unintended consequences. The following methodological approach is recommended based on the research literature:

The primary strategy employs targeted gene disruption using homologous recombination. The most efficient approach uses a PCR-generated disruption cassette containing a selectable marker (such as KanMX conferring G418 resistance) flanked by 40-60 base pairs of sequence homologous to regions upstream and downstream of the SDH4 coding sequence. After transformation, selection on appropriate media containing G418 identifies potential knockouts .

Confirmation of successful disruption is critical and should involve multiple complementary methods:

  • PCR verification using primers flanking the integration site

  • Southern blot analysis to confirm proper integration

  • RT-PCR or Northern blot to verify absence of SDH4 transcript

  • Western blot analysis to confirm absence of Sdh4p protein

  • Phenotypic characterization, particularly assessment of respiratory growth

Interestingly, research has shown that SDH4 disruption mutants retain some ability to grow on rich glycerol medium, suggesting compensatory mechanisms or partial functionality of SDH4 homologs like SHH4 . This observation highlights the importance of thorough phenotypic characterization of the knockout strain.

For complementation studies, the knockout strain should be transformed with vectors expressing either wild-type SDH4 or variant forms (mutants or homologs). Complementation can be assessed by restoration of respiratory growth on non-fermentable carbon sources and by direct measurement of SDH enzyme activities in isolated mitochondria .

The CRISPR-Cas9 system provides an alternative approach for generating precise knockouts with minimal off-target effects. This method uses a guide RNA targeting SDH4 along with Cas9 nuclease and a repair template containing a selectable marker. The advantage of this technique is higher efficiency and the ability to create marker-free knockouts if desired.

What analytical techniques provide the most accurate assessment of SDH activity in yeast mitochondria?

Accurate assessment of SDH activity in yeast mitochondria requires a multi-parametric approach that evaluates different aspects of enzyme function. Based on the literature, the following techniques provide complementary information about SDH functionality:

The foundation of SDH activity analysis is proper isolation of mitochondria, which should be performed using differential centrifugation followed by purification on sucrose gradients to minimize contamination with other cellular components. The integrity of isolated mitochondria should be verified using citrate synthase activity as a matrix enzyme marker .

For comprehensive assessment, researchers should employ multiple activity assays that evaluate different aspects of SDH function:

  • Succinate-dependent, PMS (phenazine methosulfate)-mediated DCPIP (2,6-dichlorophenolindophenol) reductase activity measures the catalytic function of the Sdh1p/Sdh2p dimer and its association with the membrane. This assay is particularly valuable because it does not require catalytically competent membrane subunits but does require proper membrane association .

  • Succinate:cytochrome c reductase activity measures electron transfer from succinate through the entire respiratory chain to cytochrome c, requiring functional SDH membrane domain and ubiquinone interaction .

  • Succinate:DB (2,6-dichlorophenolindophenol) reductase activity specifically assesses electron transfer from succinate to artificial ubiquinone analogs, providing a direct measure of the membrane domain functionality .

  • Quantification of covalent FAD in mitochondrial preparations provides an indirect measure of assembled SDH levels, as SDH is the major covalent flavoprotein in S. cerevisiae .

AssayWhat It MeasuresRelevance to SDH4 Function
DCPIP reductaseCatalytic dimer activity and membrane associationConfirms proper integration of Sdh4p in the membrane
Cytochrome c reductaseComplete electron transfer pathwayAssesses functional interaction with the respiratory chain
DB reductaseMembrane domain functionalityDirectly evaluates Sdh3p/Sdh4p function in electron transfer
Covalent FADAssembled SDH levelsQuantifies the amount of properly assembled enzyme

To ensure accuracy, all activity measurements should be normalized to protein concentration and presented as specific activities. Multiple biological replicates (at least three) should be analyzed to account for preparation variability, and appropriate controls (such as wild-type strains and known SDH4 mutants) should be included in each experiment .

How can researchers analyze the expression correlation between SDH4 and other genes across different metabolic conditions?

Analyzing expression correlations between SDH4 and other genes requires an integrated approach combining high-throughput transcriptomic methods with targeted validation techniques. Based on the literature, the following methodological framework is recommended:

For global correlation analysis, RNA-Seq provides comprehensive transcriptome profiling across different metabolic conditions. Key conditions to examine include:

  • Fermentative growth (glucose-rich media)

  • Respiratory growth (non-fermentable carbon sources like glycerol or ethanol)

  • Nutrient limitation (particularly glucose limitation)

  • Environmental stress responses

  • Metabolic transitions (diauxic shift)

  • Specialized metabolic states (peroxisome induction/repression, sporulation)

Data analysis should employ robust statistical methods:

  • Calculate Pearson correlation coefficients between SDH4 and all other genes across the different conditions.

  • Apply appropriate significance thresholds with correction for multiple testing.

  • Identify gene clusters with similar expression patterns using hierarchical clustering or network analysis.

  • Compare correlation patterns across different conditions to identify condition-specific relationships.

Previous research has identified strong correlations (Pearson coefficients >0.8) between SDH1, SDH2, SDH3, and SDH4 genes during glucose limitation, environmental responses, and the fermentative to glycerol transition. Similarly, SHH3 and SHH4 show strong correlation specifically during peroxisome induction/repression and glucose limitation .

For targeted validation, quantitative RT-PCR provides a precise method to verify expression correlations for specific gene sets. This approach is particularly valuable for confirming RNA-Seq findings and for detailed examination of temporal expression patterns during metabolic transitions.

To connect expression patterns with functional significance, researchers should:

  • Construct reporter strains with fluorescent proteins expressed under the control of promoters of interest.

  • Perform ChIP-seq to identify shared transcription factors regulating co-expressed genes.

  • Create deletion strains for key transcription factors to verify their role in coordinating expression.

  • Utilize synthetic genetic array (SGA) analysis to identify genetic interactions between SDH4 and correlated genes.

Integration of these approaches provides a comprehensive understanding of the regulatory networks controlling SDH4 expression across different metabolic conditions, offering insights into the functional relationships between SDH4 and its genetic partners .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.