Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial (SDH3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDH3; CYB3; YKL141W; YKL4; Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
51-198
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SDH3
Target Protein Sequence
NVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLF TILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAK ELTLKGVYRTGYALIGFTAVLGTYLLTL
Uniprot No.

Target Background

Function

This membrane-anchored, mono-heme cytochrome b subunit of succinate dehydrogenase (SDH) is a component of mitochondrial electron transport chain Complex II. It facilitates electron transfer from succinate to ubiquinone (coenzyme Q). SDH3 and SDH4 form a membrane-bound dimer that anchors the catalytic SDH1/SDH2 dimer to the inner mitochondrial membrane's matrix surface. Electrons from the catalytic dimer are transferred to the membrane dimer for ubiquinone reduction.

Gene References Into Functions
  1. Alternative SDH subunits have been identified in the S. cerevisiae genome: one paralog of the SDH3 subunit (SHH3, YMR118c), and two paralogs of the SDH4 subunit (SHH4, YLR164w, and TIM18, YOR297c). PMID: 22573324
Database Links

KEGG: sce:YKL141W

STRING: 4932.YKL141W

Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SDH3 in Saccharomyces cerevisiae metabolism?

SDH3 functions as an essential subunit of succinate dehydrogenase (SDH), also known as succinate:ubiquinone oxidoreductase or complex II of the respiratory chain. This enzyme catalyzes a critical connection between the tricarboxylic acid (TCA) cycle and the electron transport chain by coupling the oxidation of succinate to fumarate with the reduction of ubiquinone to ubiquinol.

SDH3 forms part of the membrane domain of the enzyme complex, working alongside SDH4 to anchor the catalytic subunits (SDH1 and SDH2) to the mitochondrial inner membrane. Notably, SDH3 exhibits functional versatility beyond its role in respiration, as it has also been identified as a component of the TIM22 inner membrane translocase complex involved in protein import, where it forms a subcomplex with Tim18p.

This dual functionality demonstrates that SDH3 plays important roles in both energy generation and mitochondrial biogenesis, making it a critical component for proper cellular function.

How is the structure of SDH3 organized within the mitochondrial membrane?

SDH3 contains three transmembrane segments (TMS) as predicted by TopPred analysis. These segments span approximately residues 96-118 (TMS1), 138-158 (TMS2), and 176-196 (TMS3). The protein also possesses a mitochondrial targeting sequence at its N-terminus, predicted to be cleaved after residue 25 with high probability (p=0.95) according to MitoProt II analysis.

The membrane domain formed by SDH3 and SDH4 contains the quinone-binding site where electrons are transferred to ubiquinone. SDH3 contributes to this site through a conserved quinone-binding motif (LXXXHXXT). Additionally, His-156 in SDH3 functions as a heme axial ligand, contributing to the coordination of the b-type heme molecule that facilitates electron transfer within the complex.

What phenotypic effects are observed when SDH3 is deleted in yeast?

Deletion of SDH3 in S. cerevisiae results in significant physiological changes, most notably the inability to grow on non-fermentable carbon sources, demonstrating the essential role of SDH3 in respiratory function. When grown on glucose, sdh3Δ mutants exhibit altered metabolic patterns and significant changes in gene expression affecting various cellular processes ranging from metabolism to cell-cycle regulation.

Transcriptional analysis reveals that despite SDH having no direct role in transcriptional regulation and the flux through the SDH reaction being very low under glucose-repressed conditions, SDH3 deletion triggers widespread transcriptional responses. These changes indicate that the respiratory defect caused by SDH3 deletion affects multiple cellular systems beyond central carbon metabolism.

What are the optimal methods for generating SDH3 deletion strains in S. cerevisiae?

The recommended approach for generating SDH3 deletion strains is the cloning-free PCR-based allele replacement method. This technique involves:

  • PCR amplification of upstream and downstream regions of the SDH3 gene from genomic DNA using specific primers (e.g., SDH3_Up_Fw and SDH3_Up_Rv for the upstream fragment).

  • PCR amplification of a selectable marker cassette (such as URA3) with primers containing overhangs homologous to the SDH3 flanking regions.

  • Co-transformation of these PCR products into yeast cells, where homologous recombination replaces the SDH3 gene with the marker cassette.

  • Selection of transformants on appropriate media lacking uracil.

  • Confirmation of the deletion by PCR analysis and/or phenotypic characterization (inability to grow on non-fermentable carbon sources).

This method allows for precise deletion of the SDH3 gene without introducing unwanted modifications to the genome or requiring intermediate cloning steps.

How can one analyze the effects of respiratory chain inhibitors on SDH3 function?

A systematic approach to analyze respiratory chain inhibitor effects on SDH3 function includes:

  • Culture preparation: Grow both wild-type and sdh3Δ strains in minimal media under identical conditions to early exponential phase.

  • Inhibitor treatment: Add specific respiratory chain inhibitors at appropriate concentrations:

    • Antimycin (1 μg/ml): Inhibits complex III

    • Oligomycin (3 μg/ml): Inhibits ATP synthase

    • Carbonyl cyanide m-chlorophenylhydrazone (CCCP) (4.1 μg/ml): Uncouples oxidative phosphorylation

  • Sampling and analysis: Collect samples at regular intervals to monitor:

    • Growth (optical density or dry cell weight)

    • Glucose consumption

    • Metabolite production (ethanol, pyruvate, acetate, etc.)

    • Respiratory parameters

  • Comparative analysis: Compare the responses of wild-type and sdh3Δ strains to identify SDH3-specific effects versus general respiratory chain disruption effects.

This experimental design allows researchers to distinguish between the direct consequences of SDH3 deletion and secondary effects resulting from respiratory chain dysfunction.

What are the key functional residues in SDH3 and how can they be studied?

Several critical residues in SDH3 have been identified as essential for quinone reductase activity:

ResidueFunctionConservation in Paralogs
Ser-93Site of mev-1 mutation in C. elegans; impacts oxidative stress sensitivityConserved in Shh3p
His-96Involved in quinone reductionConserved in Shh3p
Arg-97Involved in quinone reductionConserved in Shh3p
Phe-153Involved in quinone reductionConserved in Shh3p
His-156Heme axial ligandConserved in Shh3p
His-163Involved in quinone reductionConserved in Shh3p
Trp-166Involved in quinone reductionConserved in Shh3p

These residues can be studied through:

  • Site-directed mutagenesis: Systematically alter each residue and assess the impact on enzyme activity, assembly, and stability.

  • Complementation assays: Express mutated versions of SDH3 in sdh3Δ strains and evaluate their ability to restore respiratory growth.

  • Kinetic analyses: Measure enzyme kinetics (Km, Vmax, kcat) of mutant enzymes to determine specific effects on catalytic efficiency.

  • Spectroscopic studies: Analyze heme binding and electron transfer properties using absorption spectroscopy.

The high conservation of these residues in the paralog Shh3p suggests their fundamental importance to the function of SDH membrane subunits.

How do the kinetic properties of hybrid SDH enzymes containing SDH3 paralogs compare to wild-type SDH?

Hybrid SDH enzymes containing paralogous subunits exhibit distinct kinetic properties compared to the wild-type enzyme. The key parameters are summarized in the following table:

Enzyme CompositionDCPIP Reductase Activity (% of WT)Cytochrome c Reductase Activity (% of WT)DB Reductase Activity (% of WT)kcat/Km Efficiency (% of WT)
Wild-type (Sdh3p/Sdh4p)100%100%100%100%
Hybrid (Shh3p/Sdh4p)100%64%57%74%
Hybrid (Sdh3p/Shh4p)73%30%23%27%
Double hybrid (Shh3p/Shh4p)71%60%49%69%

These data reveal several important findings:

  • All hybrid enzymes show efficient enzyme assembly as indicated by DCPIP reductase activity.

  • The Shh3p-containing hybrid retains more activity than the Shh4p-containing hybrid.

  • Interestingly, the double hybrid (Shh3p/Shh4p) shows higher activity than the Sdh3p/Shh4p hybrid, suggesting compensatory interactions between the paralogous subunits.

  • The apparent Km values for DB (decylubiquinone) differed by less than 2-fold for hybrid enzymes compared to wild-type SDH.

These kinetic differences correlate with growth phenotypes, with Shh3p supporting nearly wild-type respiratory growth while Shh4p exhibits reduced complementation efficiency.

What global transcriptional changes occur in response to SDH3 deletion?

Despite SDH3 having no direct role in transcriptional regulation, its deletion triggers significant changes in gene expression across multiple cellular processes. The transcriptional response can be analyzed through:

  • Microarray analysis: Collect RNA samples from wild-type and sdh3Δ strains during exponential growth phase and perform genome-wide expression analysis. For optimal results, use duplicate samples and calculate significance of expression changes using statistical tests (e.g., Student's t-test).

  • Data normalization and filtering: Calculate expression levels using appropriate models (e.g., Perfect Match model) and extract data for annotated unique Open Reading Frames.

  • Pathway analysis: Apply the Reporter algorithm to identify key proteins involved in the cellular response to SDH3 deletion, using biomolecular interaction networks as data integration scaffolds.

The transcriptional changes observed in sdh3Δ mutants extend beyond central carbon metabolism to various cellular processes including:

  • Respiratory function

  • Stress response

  • Cell cycle regulation

  • Lipid metabolism

  • Protein synthesis and degradation

These widespread changes illustrate how a defect in a single metabolic enzyme can propagate through the cellular regulatory network to affect diverse biological processes.

How can one differentiate between the functions of SDH3 in respiratory complex II versus the TIM22 protein import complex?

Differentiating between the dual roles of SDH3 requires careful experimental design:

  • Complementation with specific mutants:

    • Generate SDH3 mutants that selectively disrupt interaction with either SDH4 or TIM18

    • Express these mutants in sdh3Δ strains and assess restoration of respiratory function versus protein import

  • Biochemical fractionation:

    • Isolate mitochondria from wild-type and mutant strains

    • Solubilize mitochondrial membranes with mild detergents

    • Separate protein complexes by blue native PAGE or gradient centrifugation

    • Analyze the distribution of SDH3 between SDH and TIM22 complexes by Western blotting

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation experiments with tagged versions of SDH3, SDH4, and TIM18

    • Use crosslinking approaches to capture transient interactions

    • Apply proximity labeling techniques to identify the interaction partners of SDH3 in different contexts

  • Functional assays:

    • Measure SDH activity using succinate-dependent, PMS-mediated DCPIP reduction

    • Assess TIM22 function through in vitro protein import assays

    • Monitor the growth phenotypes on different carbon sources and under conditions that stress either respiratory function or protein import

Notably, overexpression of SDH3 partially suppresses the growth defect of a tim22-44 mutant, demonstrating its functional role in the translocase complex independent of its role in SDH.

What spectroscopic methods can definitively determine the presence and properties of heme in yeast SDH containing SDH3?

The presence of heme in yeast SDH has been controversial due to the absence of canonical axial histidine ligands (Cys-109 in Sdh4p replaces the typical histidine). Several approaches can address this question:

Notably, other organisms like Trypanosoma cruzi have SDH enzymes with confirmed heme despite lacking canonical heme ligands, suggesting alternative coordination mechanisms may exist in yeast SDH3 as well.

What are the optimal expression systems and purification strategies for recombinant SDH3 production?

Producing functional recombinant SDH3 requires careful consideration of expression systems and purification strategies:

  • Expression systems:

    • Homologous expression in S. cerevisiae:

      • Use sdh3Δ strains complemented with plasmid-borne SDH3

      • Consider using strong constitutive promoters (e.g., TDH3) or inducible promoters (e.g., GAL1)

      • Add epitope tags (His, FLAG, etc.) for detection and purification

    • Bacterial expression:

      • Challenging due to membrane protein nature and mitochondrial targeting

      • Consider fusion with solubilizing partners (MBP, SUMO, etc.)

      • Use specialized E. coli strains for membrane protein expression

      • Express without the mitochondrial targeting sequence

  • Purification strategies:

    • Mitochondrial isolation from yeast:

      • Enzymatic spheroplasting followed by differential centrifugation

      • Further purification of mitochondrial membranes by density gradient centrifugation

    • Membrane protein solubilization:

      • Test multiple detergents (DDM, digitonin, LMNG) for optimal solubilization

      • Use gentle solubilization conditions to preserve protein-protein interactions

    • Chromatography:

      • Affinity chromatography using tags or antibodies

      • Ion exchange chromatography

      • Size exclusion chromatography to separate intact complexes

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Activity assays to confirm functionality (DCPIP reduction)

    • Spectroscopic analysis to assess cofactor (heme) incorporation

    • Mass spectrometry to confirm protein sequence and post-translational modifications

For structural studies, co-expression of SDH3 with its partner subunits (particularly SDH4) is recommended to enhance stability and facilitate proper folding and assembly of the membrane domain.

How does SDH3 and its paralogs inform our understanding of protein evolution and moonlighting functions?

The existence of functional paralogs for SDH3 (Shh3p) and SDH4 (Shh4p) in S. cerevisiae provides a valuable system for studying protein evolution and functional diversification:

  • Sequence conservation:

    • SDH3 and SHH3 share 57% sequence identity

    • Critical functional residues (Ser-93, His-96, Arg-97, Phe-153, His-156, His-163, and Trp-166) are conserved between paralogs

    • Both proteins retain mitochondrial targeting sequences and transmembrane domains

  • Functional compensation:

    • Shh3p can substitute for Sdh3p in SDH function

    • Hybrid enzymes containing Shh3p retain substantial catalytic activity (57-74% of wild-type efficiency)

    • This suggests maintenance of ancestral function despite sequence divergence

  • Moonlighting functions:

    • Sdh3p functions in both SDH and the TIM22 complex

    • This dual role demonstrates how proteins can be recruited for additional functions beyond their primary role

    • The functional integration of Sdh3p in protein import suggests evolutionary pressure for efficient use of membrane proteins

  • Complex assembly specificity:

    • Unlike Sdh3p/Shh3p, Tim18p (another paralog of Sdh4p) cannot substitute for Sdh4p in SDH function

    • This indicates that while some paralogs maintain functional flexibility, others have undergone more significant specialization

The ability to form hybrid complexes with varying levels of activity (Sdh3p/Sdh4p, Shh3p/Sdh4p, Sdh3p/Shh4p, Shh3p/Shh4p) provides insight into the constraints and flexibility in complex assembly during evolution.

What are the implications of SDH3 research for understanding human SDH-related diseases?

Research on yeast SDH3 has important implications for understanding human SDH-related diseases:

  • Disease relevance:

    • Human SDHC (ortholog of yeast SDH3) mutations are associated with paragangliomas, pheochromocytomas, renal cell carcinoma, gastrointestinal stromal tumors, and neuroblastoma

    • SDHC may also regulate apoptosis, suggesting broader roles beyond metabolism

    • The Ser-93 residue in yeast Sdh3p corresponds to the site of the mev-1 mutation in C. elegans, which confers hypersensitivity to oxidative stress and results in premature aging

  • Model system advantages:

    • Yeast provides a genetically tractable system to study SDH function and dysfunction

    • The ability to generate and characterize hybrid enzymes with paralogs offers unique insights into structure-function relationships

    • Global transcriptional and metabolic profiling in sdh3Δ mutants helps understand cellular responses to SDH impairment

  • Translational applications:

    • Identification of critical residues in yeast Sdh3p can guide interpretation of human SDHC variants

    • Understanding how SDH3 deletion affects cellular metabolism may provide insights into cancer cell metabolism where SDH is often dysregulated

    • Yeast models can be used to screen potential therapeutic compounds targeting SDH-related diseases

  • Methodological approaches:

    • Techniques developed for studying yeast SDH3 (e.g., activity assays, complex assembly analysis) can be adapted for human SDH studies

    • Yeast expression systems can be used to characterize human SDHC variants of uncertain significance

The evolutionary conservation of key structural and functional features between yeast Sdh3p and human SDHC makes S. cerevisiae an invaluable model organism for investigating the molecular mechanisms underlying SDH-related human diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.