Recombinant Saccharomyces cerevisiae Succinate/fumarate mitochondrial transporter (SFC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SFC1; ACR1; YJR095W; J1921; Succinate/fumarate mitochondrial transporter; Regulator of acetyl-CoA synthase activity
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-322
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SFC1
Target Protein Sequence
MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGR TIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGA GITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSL TAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKT RLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV REHLENLGIFKKNDTPKPKPLK
Uniprot No.

Target Background

Function
This protein transports cytoplasmic succinate, generated from isocitrate by the action of isocitrate lyase in the cytosol, into the mitochondrial matrix in exchange for fumarate.
Database Links

KEGG: sce:YJR095W

STRING: 4932.YJR095W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does SFC1 differ from other mitochondrial transporters in yeast?

S. cerevisiae possesses several mitochondrial transporters involved in TCA cycle intermediate movement. While SFC1 primarily exchanges cytosolic succinate with mitochondrial fumarate, other transporters have different substrate specificities and exchange mechanisms. Oac1 mediates oxaloacetate import by exchanging cytosolic oxaloacetate with mitochondrial sulfate, while Dic1 facilitates malate and succinate import by exchanging these cytosolic compounds with mitochondrial phosphate .

The key functional differences include:

TransporterPrimary SubstratesExchange PartnerPhysiological Role
SFC1Succinate/FumarateFumarate/SuccinateExchanges C4 compounds without net uptake
Oac1OxaloacetateSulfateAnaplerotic replenishment of TCA intermediates
Dic1Malate, SuccinatePhosphateAnaplerotic replenishment of TCA intermediates

These transporters collectively regulate the distribution of TCA cycle intermediates between cytosolic and mitochondrial compartments .

How does SFC1 impact metabolic engineering strategies for succinate production?

SFC1 plays a critical role in metabolic engineering of S. cerevisiae for enhanced succinate production. Research has revealed several key aspects:

  • Wasteful Metabolic Cycling: In strains engineered with the reductive TCA (rTCA) pathway for succinate production, SFC1 can create an undesired cycle where:

    • Cytosolic succinate enters mitochondria via SFC1 in exchange for fumarate

    • Mitochondrial succinate is oxidized to fumarate by the succinate dehydrogenase complex

    • Mitochondrial fumarate returns to cytosol via SFC1

    • Cytosolic fumarate is reduced back to succinate, consuming valuable NADH

  • Deletion Strategy Benefits: Deleting SFC1 helps prevent this wasteful cycle, particularly in strains designed to produce succinate from glycerol with net CO2 fixation. This genetic modification redirects carbon flux toward the desired product and conserves NADH for the reductive pathway .

  • Synergistic Deletions: The highest improvement in succinate production has been achieved through combined deletion strategies, particularly deleting both MPC3 (mitochondrial pyruvate carrier) and SDH1 (succinate dehydrogenase complex component), which functionally interact with SFC1-mediated transport .

These findings highlight the importance of considering mitochondrial transport processes when designing metabolic engineering strategies for succinate production.

What methods can be used to express and purify recombinant SFC1 for biochemical studies?

For researchers interested in biochemical characterization of SFC1, the following methodology is recommended:

  • Expression System Selection:

    • Escherichia coli BL21(DE3) has been successfully used to express recombinant membrane transporters similar to SFC1

    • Alternative systems include Pichia pastoris or cell-free expression systems for challenging membrane proteins

  • Vector Design:

    • Construct expression vectors containing the SFC1 gene with an N-terminal His-tag for purification

    • Include appropriate promoters (T7 for E. coli systems) and codon optimization if necessary

  • Expression Conditions:

    • Transform expression hosts with the constructed plasmid

    • Optimize expression conditions: temperature (typically 16-25°C after induction), IPTG concentration, and expression duration

  • Purification Protocol:

    • Cell lysis: Sonication or mechanical disruption in buffer containing detergents suitable for membrane proteins

    • Purification via Ni-NTA affinity chromatography

    • Further purification using size-exclusion chromatography if needed

  • Storage Considerations:

    • Store purified protein as a lyophilized powder or in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol for long-term storage at -20°C/-80°C

Researchers should verify protein purity using SDS-PAGE and confirm functionality through transport assays in reconstituted proteoliposomes.

How can researchers measure and characterize SFC1 transport activity in vitro?

Characterizing SFC1 transport activity requires specialized approaches appropriate for membrane proteins:

  • Liposome Reconstitution System:

    • Purified SFC1 can be reconstituted into liposomes composed of phospholipids (typically a mixture of phosphatidylcholine and phosphatidylethanolamine)

    • Preload liposomes with substrate (fumarate) at known concentrations

    • Initiate transport by adding external substrate (succinate) and measure exchange rates

  • Transport Measurement Methods:

    • Radioactive substrate approach: Use 14C-labeled succinate or fumarate to trace transport

    • Spectrophotometric assays: Couple transport to enzymatic reactions that produce measurable signals

    • Fluorescence-based methods: Utilize fluorescent substrate analogs or pH-sensitive fluorophores if transport is coupled to proton movement

  • Kinetic Parameter Determination:

    • Measure initial transport rates at varying substrate concentrations

    • Plot data according to Michaelis-Menten kinetics to determine Km and Vmax values

    • Analyze data using appropriate software like GraphPad Prism or similar tools

  • Inhibitor Studies:

    • Test potential inhibitors by preincubating proteoliposomes with candidate compounds

    • Determine IC50 values through dose-response experiments

    • Use competition assays to identify substrate specificity

Similar approaches have been effectively used to characterize other mitochondrial transporters and can be adapted specifically for SFC1.

What is the functional relationship between SFC1 and the succinate dehydrogenase complex?

SFC1 and the succinate dehydrogenase (SDH) complex exhibit important functional interactions that impact cellular metabolism:

  • Metabolic Connection:

    • SFC1 mediates the exchange of cytosolic succinate for mitochondrial fumarate

    • The SDH complex (containing Sdh1 as a subunit) catalyzes the oxidation of mitochondrial succinate to fumarate while reducing FAD

    • Together, these processes can create a pathway where electrons from cytosolic NADH (via the reductive TCA pathway) ultimately feed into the mitochondrial respiratory chain

  • Experimental Evidence:

    • Deletion of SDH1 (encoding a component of the SDH complex) disrupts this connection and improves succinate production in engineered strains

    • Combined deletion of SFC1 and SDH1-related genes shows synergistic effects on redirecting carbon flux

  • Mechanistic Model:
    When both systems are intact, the following cycle can occur:

    • Cytosolic succinate enters mitochondria via SFC1

    • SDH complex oxidizes succinate to fumarate

    • Fumarate exits mitochondria via SFC1

    • Cytosolic fumarate is reduced back to succinate, consuming NADH

This metabolic relationship is particularly important in strains engineered for succinate production, where preventing this cycle by deletion of either component can significantly improve product yields .

How do mitochondrial pyruvate carriers (MPCs) and SFC1 collectively influence central carbon metabolism?

The interplay between mitochondrial pyruvate carriers (MPCs) and SFC1 represents a critical junction in cellular metabolism:

  • Coordinated Control of Carbon Entry and Exit:

    • MPCs (particularly Mpc1 and Mpc3) control pyruvate entry into mitochondria, influencing acetyl-CoA formation and TCA cycle activity

    • SFC1 mediates exchange of succinate and fumarate between cytosol and mitochondria

    • Together, these transporters regulate carbon flux through central metabolism

  • Synergistic Effects in Metabolic Engineering:

    • Research has demonstrated that combined deletion of MPC3 and SDH1 (which functionally interacts with SFC1) yields the highest improvement in succinate production

    • This suggests that coordinated engineering of both entry (pyruvate) and intermediate exchange (succinate/fumarate) points optimizes metabolic flux

  • Experimental Findings:
    Studies targeting mitochondrial transporters have shown:

    Genetic ModificationEffect on Succinate ProductionProposed Mechanism
    Δmpc3Moderate improvementReduced pyruvate entry into mitochondria
    Δsdh1Moderate improvementPrevented succinate oxidation in mitochondria
    Δmpc3 Δsdh1Highest improvementCombined reduction of both pyruvate entry and succinate oxidation

    These findings demonstrate the importance of considering multiple transport systems when designing metabolic engineering strategies .

What are the most effective experimental approaches to study the in vivo role of SFC1?

Investigating SFC1's in vivo function requires multiple complementary approaches:

  • Genetic Modification Strategies:

    • Gene deletion (Δsfc1) using homologous recombination or CRISPR-Cas9

    • Controlled expression using inducible promoters (e.g., GAL1 promoter)

    • Tagged versions (GFP, FLAG, His) for localization and interaction studies

    • Site-directed mutagenesis to create specific functional variants

  • Metabolic Analysis:

    • Metabolomics to measure changes in TCA cycle intermediates and related compounds

    • 13C-metabolic flux analysis to quantify alterations in carbon flow

    • Measurement of NADH/NAD+ ratios to assess redox impacts

    • Analysis of mitochondrial oxygen consumption rates

  • Physiological Characterization:

    • Growth assays under different carbon sources (glucose, glycerol, ethanol)

    • Stress tolerance assessments

    • Product formation analysis in wild-type versus mutant strains

  • Transcriptional and Proteomic Analysis:

    • RNA-Seq to identify genes affected by SFC1 deletion

    • Proteomics to characterize changes in protein abundance

    • Phosphoproteomics to detect alterations in signaling pathways

  • Microscopy Approaches:

    • Fluorescence microscopy with labeled SFC1 to confirm mitochondrial localization

    • Super-resolution techniques to study distribution within mitochondria

    • FRET-based approaches to detect protein-protein interactions

These methodologies collectively provide a comprehensive understanding of SFC1's role in cellular metabolism and its potential for biotechnological applications.

How can researchers model the impact of SFC1 in genome-scale metabolic models?

Incorporating SFC1 function into genome-scale metabolic models (GEMs) of S. cerevisiae requires specific considerations:

  • Reaction Definition and Compartmentalization:

    • Define the SFC1-mediated reaction as: succinate[c] + fumarate[m] ↔ succinate[m] + fumarate[c]

    • Ensure proper compartmentalization between cytosolic [c] and mitochondrial [m] metabolites

    • Assign correct gene association with YJR095W (SFC1)

  • Transport Constraints:

    • Set appropriate constraints based on experimental data on transport kinetics

    • Consider thermodynamic constraints based on concentration gradients

    • Include regulatory constraints if information on regulation is available

  • Integration with Existing Models:

    • Start with established yeast GEMs (such as Yeast 8.0) and refine transport reactions

    • Ensure stoichiometric balance and mass conservation

    • Validate model predictions against experimental data from SFC1 deletion strains

  • Analysis Techniques:

    • Flux Balance Analysis (FBA) to predict optimal metabolic distributions

    • Flux Variability Analysis (FVA) to determine ranges of possible flux values

    • Minimization of Metabolic Adjustment (MOMA) to predict the effect of SFC1 deletion

  • Software Implementation:

    • Use established tools such as COBRA Toolbox (MATLAB) or COBRApy (Python)

    • Develop customized scripts for specific analyses related to SFC1 function

    • Integrate with visualization tools to interpret results

This modeling approach enables researchers to predict the system-level consequences of manipulating SFC1 and design more effective metabolic engineering strategies.

What contradictions or knowledge gaps exist in our current understanding of SFC1 function?

Several significant knowledge gaps and contradictions exist in the current understanding of SFC1:

  • Directionality of Transport:

    • While SFC1 is often described as exchanging cytosolic succinate for mitochondrial fumarate, the preferred directionality under various physiological conditions remains unclear

    • The factors determining transport direction in vivo need further investigation

  • Substrate Specificity Range:

    • The complete range of substrates beyond succinate and fumarate that can be transported by SFC1 requires clarification

    • Whether SFC1 can transport other structurally similar dicarboxylic acids at physiologically relevant rates is not fully established

  • Regulatory Mechanisms:

    • The detailed transcriptional, translational, and post-translational regulation of SFC1 under different metabolic conditions remains to be fully elucidated

    • How SFC1 activity is coordinated with other metabolic processes is not completely understood

  • Protein-Protein Interactions:

    • Potential interactions between SFC1 and other proteins, including components of the respiratory chain or other transporters, need further investigation

    • Whether SFC1 functions as part of larger protein complexes is unknown

  • Strain-Specific Variations:

    • Differences in SFC1 function between laboratory and industrial yeast strains have not been systematically characterized

    • How genetic background influences SFC1 activity and its metabolic impact requires more research

Addressing these knowledge gaps will require new experimental approaches including advanced structural biology techniques, in vivo transport measurements, and systems biology analyses that integrate multiple levels of data.

How can researchers optimize expression systems for producing recombinant SFC1?

Optimizing expression systems for recombinant SFC1 production requires careful consideration of several factors:

  • Host Selection:

    • For structural and biochemical studies:

      • E. coli BL21(DE3): Commonly used for high-yield expression

      • C41(DE3) or C43(DE3): Modified strains better suited for membrane proteins

      • Pichia pastoris: Eukaryotic alternative with native membrane composition

    • For functional studies:

      • S. cerevisiae SFC1 deletion strains for complementation

  • Vector Design Optimization:

    • Promoter selection (T7 for E. coli, GAL1 for yeast)

    • Codon optimization for the chosen expression host

    • Fusion partners to enhance solubility and expression:

      • N-terminal His-tag for purification

      • Fusion proteins (MBP, SUMO) with cleavage sites

      • GFP fusion for expression monitoring and folding assessment

  • Expression Condition Optimization:

    • Temperature (typically 16-25°C for membrane proteins)

    • Inducer concentration (IPTG for E. coli, galactose for yeast)

    • Expression duration (typically 12-24 hours for membrane proteins)

    • Media composition (supplementation with glycerol, specific phospholipids)

  • Extraction and Purification Strategy:

    • Detergent screening for optimal solubilization

    • Purification protocol optimization:

      • Buffer composition (pH 8.0 buffer with stabilizing agents)

      • Addition of 6% trehalose for stability

      • Use of glycerol (5-50%) for storage

  • Functional Verification:

    • Transport activity assays in proteoliposomes

    • Circular dichroism to verify secondary structure

    • Thermal stability assessment

By systematically optimizing these parameters, researchers can develop robust protocols for producing functional recombinant SFC1 suitable for various experimental applications.

What are the emerging technologies for studying SFC1 and other mitochondrial transporters?

Several cutting-edge technologies are revolutionizing the study of mitochondrial transporters like SFC1:

  • Advanced Structural Biology Methods:

    • Cryo-electron microscopy (cryo-EM) for high-resolution structure determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for studying protein dynamics and substrate binding

    • Solid-state NMR for studying membrane proteins in native-like environments

  • Novel Membrane Mimetic Systems:

    • Nanodiscs: Disc-shaped phospholipid bilayers stabilized by scaffold proteins

    • Polymer-based systems: Styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Microfluidic systems for high-throughput screening of transporter activity

  • Single-Molecule Techniques:

    • Single-molecule FRET for observing conformational changes during transport

    • Fluorescence correlation spectroscopy (FCS) for measuring binding kinetics

    • High-speed atomic force microscopy for visualizing dynamic processes

  • Genetic Engineering Advances:

    • CRISPR-Cas9 for precise genome editing and creation of reporter strains

    • CRISPRi/CRISPRa for tunable repression or activation of transporter genes

    • Synthetic genomics approaches for systematic analysis of transporter function

  • Computational Methods:

    • Molecular dynamics simulations to study transport mechanisms at atomic resolution

    • Machine learning approaches for predicting transporter specificity

    • Systems biology models integrating transporter function into whole-cell metabolism

  • Metabolic Sensors:

    • Genetically encoded sensors for real-time monitoring of metabolite concentrations

    • Compartment-specific sensors to distinguish cytosolic and mitochondrial pools

    • FRET-based sensors for measuring transport activity in vivo

These emerging technologies promise to provide unprecedented insights into SFC1 structure, function, and integration with cellular metabolism, ultimately supporting more effective basic research and metabolic engineering applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.