Recombinant Saccharomyces cerevisiae Syntaxin-8 (SYN8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order. We will gladly accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you require a particular tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
SYN8; UIP2; YAL014C; FUN34; Syntaxin-8; SNARE protein related to mammalian syntaxin 8; ULP1-interacting protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SYN8
Target Protein Sequence
MDVLKLGYELDQLSDLVEERTRLVSVLKLAPTSNDNVTLKRQLGSILELLQKCAPNDELISRYNTILDKIPDTAVDKELYRFQQQVARNTDEVSKESLKKVRFKNDDELTVMYKDDDEQDEESPLPSTHTPYKDEPLQSQLQSQSQPQPPQPMVSNQELFINQQQQLLEQDSHLGALSQSIGRTHDISLDLNNEIVSQNDSLLVDLENLIDNNGRNLNRASRSMHGFNNSRFKDNGNCVIILVLIVVLLLLLLVL
Uniprot No.

Target Background

Function
Syntaxin-8 (SYN8), a t-SNARE, potentially plays a role in regulating the specificity of membrane fusion, protein transport, and vesicle trafficking within the Golgi/endosomal and plasma membrane/endosomal systems.
Database Links

KEGG: sce:YAL014C

STRING: 4932.YAL014C

Protein Families
Syntaxin family
Subcellular Location
Endosome membrane; Single-pass type IV membrane protein.

Q&A

What is Syntaxin-8 and what is its function in Saccharomyces cerevisiae?

Syntaxin-8 in Saccharomyces cerevisiae is a member of the syntaxin family that functions as a SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein REceptor) protein involved in vesicular trafficking and membrane fusion. Similar to its homologs in other organisms, S. cerevisiae Syntaxin-8 plays a critical role in protein trafficking between the trans-Golgi network (TGN) and endosomal compartments. It facilitates the fusion of transport vesicles with target membranes, particularly in the prevacuolar endosomal (PVE) system . Functionally, this protein contributes to the maintenance of endosomal integrity and plays a significant role in the cellular response to environmental stresses, particularly ionic stress conditions .

In comparative studies with other fungal models such as Schizosaccharomyces pombe, homologous Stx8 proteins demonstrate requirements for optimal growth under saline stress and proper PVE morphology and function . The molecular function of Syntaxin-8 depends critically on its SNARE domain, which mediates the formation of SNARE complexes with other complementary SNAREs to drive membrane fusion events in the endocytic pathway.

How does Saccharomyces cerevisiae Syntaxin-8 compare structurally to syntaxin-8 proteins in other organisms?

Syntaxin-8 in S. cerevisiae shares significant structural similarities with homologous proteins in other organisms while maintaining species-specific features. Based on comparative analyses with other fungal species:

SpeciesIdentity with Human Syntaxin-8Similarity with Human Syntaxin-8SNARE Domain Comparison
Schizosaccharomyces pombe Stx818%41%29% identical, 53% similar
Saccharomyces cerevisiae SYN8Similar to S. pombe valuesSimilar to S. pombe valuesContains conserved SNARE motif
Human Syntaxin-8100% (reference)100% (reference)Reference structure
Rat Syntaxin-8High (not specified)High (not specified)Contains coiled-coil regions

Like other syntaxins, S. cerevisiae Syntaxin-8 contains regions that can form coiled-coil structures critical for SNARE complex assembly . It possesses a characteristic C-terminal hydrophobic domain that serves as a membrane anchor, similar to the 18-residue hydrophobic domain identified in rat syntaxin-8 . While the sequence conservation may be moderate across distant species, the functional domains and structural elements critical for SNARE activity remain conserved, allowing Syntaxin-8 to participate in evolutionarily conserved membrane trafficking pathways .

What phenotypes are associated with SYN8 deletion in S. cerevisiae?

Deletion of the SYN8 gene in S. cerevisiae results in several observable phenotypes that reflect its functional significance in cellular processes. Based on studies of homologous proteins in related yeast species:

PhenotypeDescriptionSeverity
Growth under ionic stressSensitivity to potassium and magnesium saltsModerate to significant
Endosomal morphologyAltered prevacuolar endosome structureSignificant
Protein sortingDefects in trafficking of vacuolar proteinsModerate
Osmotic stress responseNo significant sensitivity to non-ionic osmotic stress (e.g., sorbitol)Minimal

SYN8 deletion mutants (syn8Δ) demonstrate impaired growth in the presence of ionic stressors such as KCl, KNO₃, and MgCl₂, but generally show normal growth under standard conditions . This suggests that Syntaxin-8 plays a specialized role in cellular adaptation to ionic environmental challenges rather than being essential for basic cellular functions. The endosomal system in syn8Δ mutants exhibits altered morphology and function, with defects in the sorting and processing of proteins destined for the vacuole . These phenotypes are specifically linked to the loss of the SNARE function, as demonstrated by similar defects observed in mutants expressing Syntaxin-8 lacking the SNARE domain .

How does the retromer complex interact with Syntaxin-8 in S. cerevisiae, and what are the implications for endosomal recycling?

The interaction between Syntaxin-8 and the retromer complex represents a sophisticated regulatory mechanism for endosomal protein sorting and recycling in S. cerevisiae. Studies in the related yeast S. pombe have revealed that Stx8 (homologous to S. cerevisiae Syntaxin-8) is a retromer cargo, with its retrograde trafficking from the prevacuolar endosome (PVE) to the trans-Golgi network (TGN) dependent on the retromer cargo-selective complex (CSC) and its associated sorting nexins Vps5, Vps17, and Snx3 .

The retromer binding motif in Stx8 has been identified as a GsdIEMeaM sequence, which differs from classical retromer sorting motifs that typically include bulky aromatic residues . This distinctive motif is functionally similar to the GxxIEMQxIx sorting motif found in polycystin-2 homologues, suggesting potential evolutionary convergence in retromer cargo recognition sequences .

ComponentRole in Syntaxin-8 TraffickingFunction
Retromer CSC (Vps26-Vps29-Vps35)Recognition of sorting motifCore cargo selection
Vps5Membrane tubulation and sortingBAR domain protein
Vps17Membrane tubulation and sortingBAR domain protein
Snx3Cargo recognition and recruitmentPX domain protein

The implications of this interaction are significant for understanding endosomal recycling pathways. The retromer-mediated recycling of Syntaxin-8 ensures its proper localization at the TGN and PVE, which is essential for maintaining the integrity of these compartments and their associated trafficking pathways . Disruption of this recycling mechanism likely contributes to the endosomal morphology defects and stress sensitivity observed in syntaxin-8 mutants, highlighting the importance of this SNARE protein in the dynamic regulation of the endosomal system.

What is the role of Syntaxin-8 in the stress response of S. cerevisiae, and how does it compare to stress-related functions in other organisms?

Syntaxin-8 in S. cerevisiae plays a specialized role in cellular adaptation to environmental stresses, particularly ionic stress conditions. Based on studies of homologous proteins, yeast cells lacking functional Syntaxin-8 (syn8Δ) exhibit significant sensitivity to ionic stressors such as potassium and magnesium salts, but show normal responses to non-ionic osmotic stress (e.g., sorbitol) . This specific sensitivity pattern suggests that Syntaxin-8 mediates adaptive responses to ionic challenges rather than general osmotic stress.

The stress-related functions of Syntaxin-8 appear to be conserved across fungal species but with species-specific adaptations:

OrganismStress Response InvolvementAssociated Phenotypes
S. cerevisiae SYN8Ionic stress adaptationSensitivity to K+ and Mg2+ salts
S. pombe Stx8Ionic stress adaptationSensitivity to K+ and Mg2+ salts
Mammalian Syntaxin-8Cell-specific stress responsesContext-dependent

The molecular mechanism underlying Syntaxin-8's role in stress response likely involves its SNARE function in vesicular trafficking. During ionic stress, cells may require enhanced or modified endosomal trafficking to regulate the localization of ion transporters and channels, processes in which Syntaxin-8 would play a crucial role . The SNARE domain is essential for this function, as demonstrated by the observation that expression of Syntaxin-8 lacking the SNARE domain fails to complement the salt sensitivity phenotype of syn8Δ mutants .

Comparative analysis suggests that while the specific stressors and response mechanisms may vary across species, the fundamental role of Syntaxin-8 in facilitating adaptive vesicular trafficking during stress conditions represents an evolutionarily conserved function of this SNARE protein.

How do researchers effectively generate and validate recombinant S. cerevisiae strains expressing modified Syntaxin-8 variants?

Generating and validating recombinant S. cerevisiae strains expressing modified Syntaxin-8 variants requires a systematic approach integrating molecular cloning, transformation, and functional validation techniques:

Generation Strategy:

  • Molecular Cloning Approach:

    • PCR amplification of the SYN8 gene with appropriate restriction sites

    • Site-directed mutagenesis for specific modifications (domain deletions, point mutations)

    • Insertion into suitable yeast expression vectors (episomal or integrative)

  • Transformation Methods:

    • Lithium acetate (LiAc)-mediated transformation for high efficiency introduction of constructs

    • Integration at the native locus using homologous recombination for physiological expression levels

    • Verification of transformation success through selective markers and PCR confirmation

Transformation MethodEfficiencyApplication Scenario
LiAc-mediatedModerate-HighStandard laboratory transformations
ElectroporationVery HighDifficult-to-transform strains
SpheroplastHighSpecialized applications

Validation Strategy:

  • Expression Verification:

    • Western blotting to confirm expression levels and protein size

    • Fluorescent tagging (e.g., GFP fusion) for localization studies

    • qRT-PCR for transcript level analysis

  • Functional Validation:

    • Growth assays under various stress conditions (especially ionic stress with KCl, MgCl₂)

    • Microscopic analysis of endosome morphology using appropriate markers

    • Protein trafficking assays tracking model cargo proteins

  • Interaction Studies:

    • Co-immunoprecipitation to verify SNARE complex formation

    • Yeast two-hybrid analysis for protein-protein interactions

    • In vitro binding assays with purified components

When designing recombinant SYN8 variants, researchers should pay particular attention to the SNARE domain and potential retromer sorting motifs, as these regions are critical for protein function and trafficking . For systematic studies, a recommended approach is to create a comprehensive set of domain deletion mutants and point mutations affecting key functional residues, expressed from the native promoter to maintain physiological regulation of expression.

What are the optimal protocols for purifying recombinant Syntaxin-8 from S. cerevisiae for structural and functional studies?

Purification of recombinant Syntaxin-8 from S. cerevisiae requires specialized approaches that address the challenges associated with membrane protein isolation while preserving structural and functional integrity:

Expression System Options:

SystemAdvantagesDisadvantagesBest For
Native S. cerevisiaeProper folding, authentic modificationsLower yieldsFunctional studies
E. coli heterologousHigh yields, simplified purificationPotential folding issuesStructural studies, antibody production
Insect cell expressionGood yield with eukaryotic processingHigher cost, complexityComplex structural studies

For prokaryotic expression (as seen with human Syntaxin-8), the recombinant protein is typically expressed without tags for native structure preservation, with predicted molecular weight around 24.6 kDa .

Recommended Purification Protocol:

  • Cell Preparation:

    • Culture S. cerevisiae expressing epitope-tagged Syntaxin-8 (His6, FLAG, or biotin tag recommended)

    • Harvest cells in mid-log phase

    • Prepare spheroplasts using zymolyase treatment

  • Membrane Fraction Isolation:

    • Lyse cells by mechanical disruption (glass beads or French press)

    • Separate membrane fraction through differential centrifugation

    • Solubilize membrane proteins with appropriate detergents (e.g., n-dodecyl-β-D-maltoside, CHAPS)

  • Affinity Purification:

    • Use nickel-NTA resin for His-tagged proteins

    • Apply stringent washing steps to remove contaminants

    • Elute with imidazole gradient

  • Further Purification:

    • Size exclusion chromatography for increased purity

    • Ion exchange chromatography as needed

  • Quality Control:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry for accurate mass determination

    • Circular dichroism to assess secondary structure

For functional studies, it is critical to verify that the purified protein retains its ability to form SNARE complexes in vitro. This can be tested through in vitro binding assays with complementary SNARE proteins and analysis by native PAGE or analytical ultracentrifugation.

How can researchers effectively analyze the interaction network of Syntaxin-8 in S. cerevisiae?

Analyzing the interaction network of Syntaxin-8 in S. cerevisiae requires a multi-faceted approach that combines genetic, biochemical, and advanced imaging techniques:

Comprehensive Interaction Mapping Strategies:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express epitope-tagged Syntaxin-8 in S. cerevisiae

    • Perform crosslinking to capture transient interactions

    • Identify interacting proteins by mass spectrometry

    • Validate key interactions through reciprocal pull-downs

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Implement membrane yeast two-hybrid system for membrane proteins

    • Use Syntaxin-8 domains as baits to identify domain-specific interactions

    • Transform S. cerevisiae strain AH109 with bait plasmids using lithium acetate method

    • Validate interactions through growth on selective media and reporter gene activation

  • Genetic Interaction Screens:

    • Perform synthetic genetic array (SGA) analysis with syn8Δ mutant

    • Identify synthetic lethal and synthetic sick interactions

    • Map genetic interactions to functional pathways

Interactome Analysis MethodStrengthsLimitationsKey Applications
AP-MSCaptures native complexesMay miss transient interactionsCore complex identification
Y2HDetects direct interactionsPotential false positivesBinary interaction mapping
SGAReveals functional relationshipsIndirect interactionsPathway mapping
BioID proximity labelingCaptures neighborhoodNot all labeled proteins interactSpatial interactome
  • Advanced Imaging Approaches:

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in vivo

    • Förster Resonance Energy Transfer (FRET) for quantitative interaction analysis

    • Co-localization studies with fluorescently tagged proteins (e.g., Cherry-Stx8 and Vps10-GFP)

For analyzing SNARE complex formation specifically, researchers should investigate the incorporation of Syntaxin-8 into the 20S protein complex through NSF and α-SNAP-dependent assembly assays, similar to those used for mammalian syntaxin 8 . These assays can reveal whether S. cerevisiae Syntaxin-8 functions as a true SNAP receptor (SNARE) and identify its SNARE partners in specific trafficking pathways.

What experimental designs best capture the functional impact of Syntaxin-8 on vesicular trafficking in S. cerevisiae?

To effectively capture the functional impact of Syntaxin-8 on vesicular trafficking in S. cerevisiae, researchers should implement complementary experimental approaches that address different aspects of trafficking dynamics:

Recommended Experimental Designs:

  • Cargo Trafficking Assays:

    • Track fluorescently tagged cargo proteins (e.g., Vps10-GFP, Ub:GFP-Cps1)

    • Implement pulse-chase experiments with inducible cargo expression

    • Compare trafficking kinetics between wild-type and syn8Δ strains

    • Quantify colocalization with compartment markers over time

  • Compartment Morphology Analysis:

    • Utilize fluorescent markers for specific compartments (e.g., Cherry-FYVE for PVE)

    • Perform 3D reconstruction of compartment morphology

    • Measure size, number, and distribution of endosomal structures

    • Compare morphological parameters between wild-type and mutant strains

Trafficking ParameterMeasurement ApproachExpected SYN8 Impact
Cargo sorting efficiencyQuantification of mislocalized cargoDecreased in syn8Δ
Endosome morphologyMicroscopic analysis with specific markersAltered in syn8Δ
Protein processingWestern blot analysis of processed formsDefective in syn8Δ
Stress responseGrowth assays with ionic stressorsImpaired in syn8Δ
  • Biochemical Trafficking Assays:

    • Analyze proteolytic processing of model vacuolar proteins

    • Monitor accumulation of free GFP from Ub:GFP-Cps1 by western blotting

    • Quantify rates of protein degradation using cycloheximide chase

    • Measure enzyme activities of mislocalized hydrolases

  • Genetics-Based Functional Analysis:

    • Create domain deletion variants (e.g., syntaxin-8 lacking the SNARE domain)

    • Perform complementation tests with mutant variants

    • Implement synthetic genetic array analysis to identify functional relationships

    • Use temperature-sensitive alleles for conditional phenotype analysis

A particularly powerful approach involves combining these methods in a comprehensive phenotypic analysis of SYN8 mutants under various stress conditions, especially ionic stress (KCl, MgCl₂, KNO₃) . This multiparametric analysis can reveal how Syntaxin-8 coordinates vesicular trafficking responses to environmental challenges and identify the specific trafficking steps that depend on its SNARE activity.

For advanced studies, researchers can implement in vitro reconstitution of membrane fusion using liposomes containing purified Syntaxin-8 and its SNARE partners to directly assess its role in the mechanics of membrane fusion events.

What are the most promising approaches for studying evolutionary divergence of Syntaxin-8 sorting motifs across fungal species?

The evolutionary divergence of Syntaxin-8 sorting motifs across fungal species represents a fascinating area for future research, particularly given the observation that these motifs might have undergone significant evolutionary changes while maintaining functional similarity:

Recommended Research Approaches:

  • Comparative Genomics and Phylogenetic Analysis:

    • Construct comprehensive phylogenetic trees of syntaxin-8 homologs across fungal species

    • Align and compare putative sorting motifs across evolutionary distance

    • Analyze selection pressures on different protein domains using dN/dS ratios

    • Compare divergence rates of sorting motifs versus SNARE domains

  • Motif Swap Experiments:

    • Generate chimeric proteins with sorting motifs exchanged between species

    • Test functionality of chimeric proteins in heterologous expression systems

    • Evaluate retromer interaction and trafficking of chimeric constructs

    • Determine the minimal motif requirements across species

Analytical ApproachKey Questions AddressedTechnical Requirements
Phylogenetic analysisEvolutionary relationships of sorting motifsComprehensive sequence database
Structural modeling3D organization of motif-retromer interactionsHomology modeling expertise
Functional complementationConservation of sorting mechanismCross-species expression systems
Motif-specific mutagenesisCritical residues for recognitionSite-directed mutagenesis, trafficking assays

The unique GsdIEMeaM sorting motif identified in S. pombe Stx8, which differs from typical retromer sorting motifs but resembles the GxxIEMQxIx motif in polycystin-2 homologues, suggests the possibility of convergent evolution in retromer cargo recognition sequences . Further investigation of this phenomenon across fungal species could illuminate general principles governing the evolution of protein trafficking systems.

How can synthetic biology approaches enhance our understanding of Syntaxin-8 function in S. cerevisiae?

Synthetic biology approaches offer powerful new avenues for investigating Syntaxin-8 function in S. cerevisiae, allowing researchers to go beyond traditional knockout and overexpression studies:

Innovative Synthetic Biology Strategies:

  • Engineered SNARE Systems:

    • Design synthetic SNARE proteins with modular, swappable domains

    • Create orthogonal SNARE systems that function independently of endogenous networks

    • Implement optogenetic control of SNARE assembly and disassembly

    • Engineer synthetic trafficking pathways with defined SNARE components

  • Synthetic Genetic Circuit Approaches:

    • Develop feedback-regulated SYN8 expression systems

    • Create synthetic genetic interactions through engineered protein dependencies

    • Implement AND/OR logic gates controlling Syntaxin-8 activity

    • Design stress-responsive circuits mediated by Syntaxin-8

  • Recombinant Population Analysis:

    • Construct synthetic recombinant populations with controlled genetic variation

    • Implement pairwise crossing of isogenic strains expressing different SYN8 variants

    • Analyze adaptation and selection in evolving populations

    • Track genetic diversity maintenance in stress conditions

Synthetic ApproachResearch ApplicationExpected Insights
Modular SNARE designSpecificity determinantsDomain contributions to function
Orthogonal traffickingParallel pathway engineeringMinimal system requirements
Population-level analysisEvolutionary trajectoriesAdaptive potential
Circuit-based regulationDynamic controlSystem integration

When constructing synthetic recombinant S. cerevisiae populations for evolutionary studies of SYN8 function, researchers should note that populations constructed using pairwise crossing of isogenic strains maintain more genetic variation than those created by simple mixing of strains . This approach can maximize the adaptive potential in evolution experiments where adaptation is primarily fueled by standing genetic variation .

Synthetic biology approaches can also be used to reconstitute minimal trafficking systems in artificial membranes or liposomes, allowing precise control over component stoichiometry and environmental conditions. Such bottom-up approaches could reveal the fundamental principles governing Syntaxin-8 function in membrane fusion and vesicular trafficking.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.