Recombinant Saccharomyces cerevisiae Topoisomerase I damage affected protein 7 (TDA7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To ensure a specific tag type, please inform us in advance, and we will prioritize its development.
Synonyms
TDA7; EC1118_1N9_1728g; Topoisomerase I damage affected protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
Target Names
TDA7
Target Protein Sequence
MNSNSTIGRTTLGESDTISLSFSEPSSSLNSRSTDVVFASTSTLVPQQGSLTSLPPVSST ATPTYYSTSLTYDETLHTSIDVSSTSTLVSSTDSSSSSEQDTYSSQYDPATSSYSIITPS MSIFSSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSSLSSPSSLLVSSSLSSSS YSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQISTTSELSSSWFSTISPSTT SNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLSPSASSSTVSISTISVPTSSSV SSSSSKVPSNRPSSSSSSDDTTSAYSSTYTFQSLQSTTSSSIPPTTQTPSTSTISTSPIP TSSQVFNTAAISSSEDSKTIYYFYTQTYDITDSSTTFVTGLPTTIAVAKSEVTSFSAPSS TITADMSFYQHWLDGSLDNNKNQGPSKTNTGTIVGSVVGSVGGILICVLVVWFMLVRKRK AKRHFKENDSFCHEIGRRTGFPTTAQAKEASLQAQDSGSQQRNTETASANNPFSNEFNFK ARGNPPPVPPPRNVTATNGSFQNMRSNFMDQENRFSYGSSFTYSSLGSSTQGGFSTLSSN SIRLGRGLDNDISHDERNTVQNNSQGFLREII
Uniprot No.

Target Background

Protein Families
TDA7 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

What is the biological function of TDA7 in Saccharomyces cerevisiae?

TDA7 (Topoisomerase I Damage Affected Protein 7) is a protein in S. cerevisiae that appears to be functionally related to topoisomerase I activity and DNA damage response pathways. While the specific molecular mechanisms remain under investigation, research suggests that TDA7 plays a role in cellular responses to DNA damage, particularly damage associated with topoisomerase I activity. Topoisomerase I alters DNA superhelicity and has been implicated in critical cellular functions including transcription, DNA replication, and recombination . TDA7 is identified in databases as a "topoisomerase I damage affected protein," suggesting its expression or function may be altered in response to topoisomerase I-mediated DNA damage . Current research indicates it may be part of broader cellular pathways that respond to changes in DNA topology and integrity in yeast cells.

How is the TDA7 gene regulated at the transcriptional level?

Transcriptional regulation of TDA7 in S. cerevisiae likely follows mechanisms similar to other yeast genes involved in DNA damage response. S. cerevisiae employs complex transcriptional regulation systems including upstream activation sequences and specific promoter structures . While TDA7-specific transcriptional regulation has not been fully characterized in the available literature, yeast typically uses several classes of transcription factors to regulate gene expression, including zinc finger proteins, bZIP proteins, and bHLH proteins that bind to specific DNA sequences .

The regulation may involve condition-dependent binding of transcription factors, as determined through techniques such as ChIP-chip and ChIP-Seq, which have been valuable for examining transcription factor binding sites in vivo . Additionally, histone deacetylases (HDACs) like Rpd3p could potentially influence TDA7 expression by modifying chromatin structure at its promoter, as HDACs create localized regions of repressed chromatin . Experimental methods to study TDA7 regulation would typically include reporter gene assays, deletion analysis of the promoter region, and genome-wide expression studies under various stress conditions.

What techniques are most effective for recombinant expression of TDA7 in yeast?

For recombinant expression of TDA7 in S. cerevisiae, researchers should consider the following methodological approach:

  • Vector Selection: Choose appropriate expression plasmids categorized as:

    • Integrative plasmids for stable expression

    • Centromeric plasmids for low copy number

    • 2μ-based plasmids for high copy number expression

  • Cloning Strategy: The DNA sequence encoding TDA7 should be amplified via PCR from genomic DNA or cDNA and cloned into a suitable expression plasmid, with or without signal sequences and fusion partners depending on research objectives .

  • Strain Selection: Consider using specialized strains from collections such as EUROSCARF (deletion strains) or tetracycline-regulated essential gene collections, which have proven valuable for optimizing recombinant protein production .

  • Expression Conditions: Optimize culture conditions including media composition, temperature, and induction timing.

The following table outlines recommended strain and vector combinations for TDA7 expression:

Expression LevelRecommended Vector TypeSuitable Strain BackgroundInduction Method
Low (physiological)Centromeric plasmidWild-type or specific deletion strainConstitutive or regulated promoter
MediumIntegrative plasmidProtease-deficient strainGAL1 or other inducible promoter
High2μ-based plasmidSpecialized expression strainStrong inducible promoter

When designing fusion tags, consider that N-terminal tags may interfere less with potential C-terminal functional domains of TDA7, though this should be experimentally verified.

What phenotypes are associated with TDA7 deletion in yeast?

While the specific phenotypes associated with TDA7 deletion are not directly described in the provided search results, insights can be drawn from related research on topoisomerase I and DNA damage response proteins in yeast. Based on its classification as a topoisomerase I damage affected protein, deletion of TDA7 might influence cellular responses to DNA damage in ways similar to, but distinct from, topoisomerase I mutations.

For comparison, a null mutation in the gene encoding topoisomerase I (TOP1) causes elevated levels of mitotic recombination in ribosomal DNA (rDNA) with minimal effects on growth . In contrast, specific missense mutations in TOP1, such as top1-103, cause more severe phenotypes including slow growth, constitutive expression of DNA damage-inducible genes, and inviability in the absence of double-strand break repair systems .

To properly characterize TDA7 deletion phenotypes, researchers should examine:

  • Growth rates under normal and stress conditions

  • DNA damage sensitivity using agents like MMS, UV radiation, or camptothecin

  • Recombination frequencies at various genomic loci

  • Synthetic lethal interactions with mutations in DNA repair pathways

  • Transcriptional profiles to identify affected pathways

Experimental analysis should include both quantitative growth measurements and molecular phenotyping to fully understand the deletion's impact on cellular physiology.

How does TDA7 interact with topoisomerase I in DNA damage response pathways?

The functional relationship between TDA7 and topoisomerase I in DNA damage response likely involves complex molecular interactions that remain to be fully elucidated. Based on our understanding of topoisomerase I function and DNA damage pathways in yeast, several potential interaction mechanisms can be proposed and investigated:

Topoisomerase I alters DNA superhelicity and is crucial for transcription, DNA replication, and recombination . When topoisomerase I activity is compromised, as seen with the top1-103 mutation, cells exhibit phenotypes including mitotic hyper-recombination, slow growth, and constitutive expression of DNA damage-inducible genes . TDA7, as a topoisomerase I damage affected protein, may function in one of several capacities:

  • As a sensor or regulator: TDA7 might recognize aberrant DNA structures or stalled topoisomerase I complexes on DNA.

  • As a mediator: It could facilitate recruitment of repair factors to sites of topoisomerase I-induced DNA damage.

  • As a feedback regulator: Similar to how ZRT1 and BNA1 regulate HDAC activity through feedback loops , TDA7 might modulate topoisomerase I activity in response to damage.

To investigate these interactions experimentally, researchers should employ:

  • Co-immunoprecipitation assays to detect physical interactions

  • ChIP-seq to identify co-localization at genomic sites

  • Synthetic genetic arrays to map genetic interactions

  • Protein-fragment complementation assays to visualize interactions in vivo

  • Proteomic analysis following DNA damage induction

Understanding this relationship is particularly important as it may parallel mechanisms in higher eukaryotes where topoisomerase I is a target for anti-cancer drugs like camptothecin .

What structural domains of TDA7 are critical for its function, and how can they be experimentally validated?

Computational Approaches:

  • Sequence analysis to identify conserved motifs or domains

  • Structural prediction using homology modeling

  • Comparison with related proteins across species

  • Identification of potential post-translational modification sites

Experimental Validation Methods:

  • Mutational Analysis: Create a series of truncation and point mutations to identify regions essential for function. Complementation assays in TDA7 deletion strains can reveal which mutant constructs rescue phenotypes.

  • Domain Swapping: Replace suspected functional domains with equivalent regions from related proteins to test conservation of function.

  • Protein Interaction Studies: Techniques such as yeast two-hybrid or affinity purification coupled with mass spectrometry can identify interaction partners, providing clues about functional domains.

  • Structural Biology Approaches: X-ray crystallography or NMR spectroscopy of purified TDA7 can reveal structural features.

  • Fluorescence Microscopy: Fusion of fluorescent tags to specific domains can track subcellular localization under various conditions.

Domain RegionPredicted FunctionPhenotype When MutatedInteraction Partners Affected
N-terminal (1-X)LocalizationMislocalizationNuclear transport factors
Middle region (X-Y)DNA bindingReduced damage responseTopoisomerase I, chromatin
C-terminal (Y-Z)Protein interactionDisrupted protein complexRepair factors

This systematic approach would provide crucial insights into how TDA7 structure relates to its function in topoisomerase I damage response pathways.

How does TDA7 expression change in response to different types of DNA damage?

Understanding how TDA7 expression responds to various DNA damaging agents requires comprehensive transcriptional profiling under different stress conditions. Based on its classification as a topoisomerase I damage affected protein, TDA7 expression likely changes in response to specific DNA damage stimuli.

Experimental Approach:

  • Expose S. cerevisiae cultures to various DNA damaging agents:

    • Camptothecin (topoisomerase I inhibitor)

    • Methyl methanesulfonate (MMS, alkylating agent)

    • UV radiation (forms pyrimidine dimers)

    • Hydroxyurea (induces replication stress)

    • Ionizing radiation (causes double-strand breaks)

  • Analyze TDA7 expression using:

    • RT-qPCR for targeted analysis

    • RNA-seq for genome-wide expression profiling

    • Reporter constructs (TDA7 promoter driving GFP/luciferase)

  • Perform time-course experiments to capture both immediate and delayed responses

  • Compare wild-type responses to those in strains with defects in specific DNA damage response pathways

The transcriptional response of TDA7 might follow patterns similar to other DNA damage-inducible genes, which are often regulated through complex mechanisms involving multiple transcription factors . For comparison, histone deacetylase inhibition by trichostatin A (TSA) has been shown to affect the expression of genes involved in DNA damage response in yeast .

A potential pattern of TDA7 expression might look like the following table, based on hypothetical experimental results that would need verification:

DNA Damaging AgentConcentrationEarly Response (1hr)Late Response (4hr)Dependent Pathway
Camptothecin5 μMStrong inductionSustainedRad9-dependent
MMS0.02%Moderate inductionDiminishingMec1-dependent
UV radiation50 J/m²Weak inductionDelayed peakRad4/Rad23-dependent
Hydroxyurea200 mMNo changeModerate inductionMrc1-dependent
Ionizing radiation100 GyModerate inductionSustainedTel1-dependent

Such analysis would reveal whether TDA7 is specifically responsive to topoisomerase I-mediated damage or plays a broader role in various DNA damage response pathways.

What are the potential applications of recombinant TDA7 in studying topoisomerase I inhibitors for cancer research?

Recombinant TDA7 from S. cerevisiae could serve as a valuable tool in cancer research, particularly in understanding the mechanisms of topoisomerase I inhibitors like camptothecin and its derivatives, which are important anti-cancer drugs. The top1-103 mutation in yeast topoisomerase I has been proposed to mimic the action of wild-type topoisomerase I in the presence of camptothecin , suggesting that studying TDA7's role in this context could provide insights into drug action mechanisms.

Potential Research Applications:

  • Drug Mechanism Studies: Recombinant TDA7 could help elucidate how cells respond to topoisomerase I inhibition at the molecular level. This is particularly valuable since the top1-103 mutation causes phenotypes that resemble the effects of camptothecin, including DNA damage and cell cycle arrest .

  • Biomarker Development: If TDA7 expression or modification changes predictably in response to topoisomerase I inhibition, it could serve as a biomarker for drug efficacy or resistance.

  • Drug Screening Platform: Yeast systems expressing recombinant TDA7 could be developed into high-throughput screens for novel topoisomerase I inhibitors.

  • Resistance Mechanism Studies: By studying how TDA7 functions in drug-resistant yeast strains, researchers might uncover novel resistance mechanisms relevant to cancer therapy.

Methodological Approaches:

  • Develop humanized yeast systems expressing both human topoisomerase I and TDA7 homologs to create more relevant drug testing platforms

  • Create reporter systems where TDA7 expression or localization serves as a readout for drug activity

  • Use comparative genomics to identify human homologs of TDA7 that might serve similar functions in cancer cells

The value of this approach lies in the conservation of basic DNA repair mechanisms between yeast and humans, allowing for initial discoveries in this model organism to inform downstream studies in cancer models. The yeast system offers simplicity, genetic tractability, and rapid experimental cycles that complement more complex mammalian models in the drug development pipeline.

What are the best conditions for purifying recombinant TDA7 protein for biochemical studies?

Purifying recombinant TDA7 from S. cerevisiae for biochemical studies requires careful optimization of expression and purification conditions. Based on general principles of yeast protein purification and the nature of proteins involved in DNA metabolism, the following methodological approach is recommended:

Expression Strategy:

  • Tag Selection: A dual-tagging approach is often effective, combining:

    • N-terminal 6xHis or FLAG tag for initial affinity purification

    • C-terminal tag like Protein A or Strep-tag II for secondary purification
      These tags can be separated from the protein by engineered protease cleavage sites.

  • Expression System: Use a galactose-inducible promoter (GAL1) in a protease-deficient strain (e.g., BJ5464) to minimize degradation during purification.

Purification Protocol:

StepMethodBuffer CompositionNotes
Cell LysisGlass bead disruption50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 0.1% NP-40, 1 mM DTT, protease inhibitorsLow-speed centrifugation to remove cell debris
Initial CaptureMetal affinity chromatographyAbove buffer + 10-30 mM imidazole for binding, 250 mM imidazole for elutionIf using 6xHis tag
Secondary PurificationIon exchange chromatography20 mM HEPES pH 7.0, 50-500 mM NaCl gradientSeparates based on charge properties
PolishingSize exclusion chromatography20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTTRemoves aggregates and ensures homogeneity
StorageFlash freezingAbove buffer + 50% glycerolStore at -80°C in small aliquots

Critical Considerations:

  • Maintain all buffers and procedures at 4°C to minimize protein degradation

  • Test protein stability with different buffers and pH conditions

  • Consider including zinc in buffers (100-200 μM ZnCl₂) if structural analysis suggests zinc-binding domains

  • Verify protein activity immediately after purification using functional assays

  • Determine optimal storage conditions to maintain activity

Since TDA7 is related to topoisomerase I function, which is known to be affected by oxidation and DNA binding, include reducing agents in all buffers and consider whether DNA should be removed during purification (using DNase treatment or high salt washes).

Protein purity should be assessed by SDS-PAGE and Western blotting, while structural integrity can be evaluated using circular dichroism spectroscopy before proceeding to functional studies.

How can ChIP-seq be optimized to study TDA7 interactions with chromatin?

Optimizing ChIP-seq (Chromatin Immunoprecipitation followed by high-throughput sequencing) for studying TDA7 interactions with chromatin requires careful consideration of several technical aspects. This technique is particularly valuable for determining condition-dependent binding and can provide nucleotide-level resolution of binding sites .

Optimized ChIP-seq Protocol for TDA7:

  • Antibody Selection/Generation:

    • If commercial antibodies against TDA7 are unavailable, epitope tagging (FLAG, HA, or Myc) can be employed

    • Validate antibody specificity using Western blotting against wild-type and TDA7-deletion strains

    • For tagged constructs, ensure the tag doesn't interfere with chromatin binding by comparing growth phenotypes with untagged strains

  • Crosslinking Optimization:

    • Test multiple formaldehyde concentrations (0.5-1.5%) and incubation times (5-20 minutes)

    • For transient or weak DNA interactions, consider using dual crosslinking with both formaldehyde and a protein-protein crosslinker like DSG (disuccinimidyl glutarate)

  • Chromatin Fragmentation:

    • Optimize sonication conditions to obtain fragments of 200-300 bp

    • Monitor fragmentation efficiency using gel electrophoresis

    • Consider enzymatic digestion as an alternative to sonication for more consistent fragmentation

  • Experimental Conditions:

    • Include appropriate controls (input DNA, IgG control, untagged strain)

    • Test multiple growth conditions, particularly those inducing DNA damage

    • For suspected transiently bound factors, use techniques like ChIP-exo or CUT&RUN for higher resolution

  • Data Analysis Pipeline:

    • Use peak-calling algorithms optimized for transcription factors or chromatin-associated proteins

    • Integrate with nucleosome positioning data to contextualize binding sites

    • Compare binding patterns under different conditions (normal growth vs. DNA damage)

Validation and Follow-up Studies:

  • Confirm selected binding sites using ChIP-qPCR

  • Correlate ChIP-seq data with transcriptome changes in TDA7 deletion strains

  • Identify DNA sequence motifs enriched at binding sites

  • Determine co-localization with topoisomerase I and other DNA repair factors

This approach is particularly valuable because condition-dependent binding of transcription factors is a well-established phenomenon in yeast , and TDA7 may show similar conditional association with chromatin, especially following DNA damage or topoisomerase I inhibition.

How can researchers integrate genomic and proteomic approaches to fully characterize TDA7 function?

Integrating genomic and proteomic approaches provides a comprehensive understanding of TDA7 function that neither method alone can achieve. This multi-omics strategy creates a systems-level view of how TDA7 operates within cellular networks and responds to environmental conditions.

Integrated Research Strategy:

  • Genomic Approaches:

    • Transcriptomics: RNA-seq analysis comparing wild-type and TDA7 deletion strains under various conditions to identify affected pathways

    • ChIP-seq/ChIP-exo: Mapping TDA7 binding sites genome-wide

    • Genetic Interaction Screens: Synthetic genetic array (SGA) analysis to identify genes functionally related to TDA7

    • CRISPR Screens: For identifying genes that modulate TDA7-dependent phenotypes

  • Proteomic Approaches:

    • Affinity Purification-Mass Spectrometry (AP-MS): Identifying TDA7 protein interaction partners

    • Proximity Labeling: BioID or APEX2 fusions to capture transient interactions

    • Post-translational Modification Mapping: Phosphorylation, ubiquitination, or other modifications of TDA7

    • Thermal Proteome Profiling: To identify proteins whose stability changes in TDA7 deletion strains

  • Integration Methods:

Data Type CombinationIntegration MethodExpected Insight
Transcriptomics + ChIP-seqOverlapping differentially expressed genes with TDA7 binding sitesDirect regulatory targets
Proteomics + Genetic interactionsNetwork analysis of physical and genetic interaction overlapFunctional protein complexes
PTM data + TranscriptomicsCorrelation of TDA7 modification states with expression changesRegulatory mechanisms
ChIP-seq + Histone modification dataCo-localization analysisChromatin environment preferences
  • Computational Framework:

    • Use machine learning approaches to identify patterns across multiple data types

    • Apply network analysis to place TDA7 in cellular pathways

    • Develop predictive models of TDA7 function based on integrated datasets

Recent advances in chromatin research have employed such integrated approaches. For example, studies of histone deacetylase function in yeast combined transcription profiling with genetic experiments to gain comprehensive insights into their roles . This has revealed how specific genes participate in feedback loops regulating HDAC activity , and similar regulatory relationships might exist for TDA7.

The power of this approach lies in its ability to distinguish direct from indirect effects, a challenge noted in previous studies where integration of binding site information with nucleosome positions and gene expression data helped resolve such questions . For TDA7, this integration could reveal whether its effects on cellular physiology are mediated through direct DNA binding, protein-protein interactions, or both.

What are the challenges in identifying human homologs of TDA7 and translating yeast findings to human systems?

Translating research findings on yeast TDA7 to human systems presents several significant challenges that researchers must address through methodical comparative analysis. These challenges span computational prediction, functional validation, and contextual differences between yeast and human cells.

Major Challenges and Solutions:

Methodological Approach:

StepMethodEvaluation Criteria
Computational predictionMulti-tool approach (BLAST, HMMer, structural prediction)Conservation of key domains and motifs
Phenotypic complementationExpress human candidates in TDA7-deletion yeastRescue of phenotypes such as DNA damage sensitivity
Reverse complementationExpress yeast TDA7 in human cell knockouts of candidate genesFunctional restoration
Network conservationCompare protein interaction networks surrounding TDA7 and human candidatesConservation of interaction partners

Case Study Framework:
Topoisomerase I damage response pathways provide an excellent framework for this translation, as topoisomerase I is well-conserved from yeast to humans and is an anti-cancer drug target . The top1-103 mutation in yeast mimics the action of wild-type topoisomerase I in the presence of camptothecin , suggesting conserved damage response mechanisms.

The translation process could be particularly valuable for understanding the fundamental biology of topoisomerase I inhibitors in cancer therapy. In this context, identifying human functional equivalents of TDA7 could potentially reveal new biomarkers or targets for enhancing the efficacy of these drugs in cancer treatment.

How might TDA7 function be affected by changes in histone modification patterns?

The function of TDA7 may be significantly influenced by histone modification patterns, creating an important intersection between DNA damage response and epigenetic regulation. Research in yeast has demonstrated that histone deacetylases (HDACs) like Rpd3p are crucial for transcriptional regulation and chromatin structure , suggesting a potential regulatory relationship with TDA7 function.

Potential Mechanisms of Interaction:

  • Accessibility Regulation: Histone modifications directly affect chromatin accessibility, potentially controlling TDA7's access to DNA. Acetylation typically increases accessibility, while deacetylation creates localized regions of repressed chromatin .

  • Recruitment Dynamics: Specific histone marks might serve as binding platforms for TDA7 or its interacting partners through specialized binding domains.

  • Transcriptional Control: Histone modifications could regulate TDA7 expression, similar to how TSA-sensitive HDACs like Rpd3p regulate specific gene sets in yeast .

Experimental Approaches:

  • Modified Chromatin Landscapes: Create yeast strains with mutations in histone modifying enzymes (HDACs, HATs, methyltransferases) and assess changes in:

    • TDA7 localization using ChIP-seq

    • TDA7-dependent phenotypes

    • TDA7 protein levels and modifications

  • Histone Variant Studies: Investigate how histone variants (like H2A.Z) affect TDA7 function.

  • Inhibitor Studies: Use chemical inhibitors of histone modifying enzymes (e.g., TSA for HDAC inhibition) to assess acute changes in TDA7 function.

A comparative analysis of histone modification states and TDA7 activity might reveal patterns similar to the following hypothetical table:

Histone ModificationEffect on ChromatinObserved Effect on TDA7Proposed Mechanism
H3K9Ac increasedOpen chromatinEnhanced recruitmentDirect accessibility
H3K27me3 increasedRepressed chromatinReduced activityExclusion from binding sites
H4 hyperacetylationOpen chromatinAltered binding patternChanged target specificity
H2A.Z incorporationDynamic chromatinIncreased damage responseEnhanced recognition of damage

This research direction is particularly promising given that TSA treatment has been shown to induce histone hyperacetylation in yeast , and studies have combined transcription profiling with genetic experiments to study HDAC function . Similar approaches could reveal how TDA7 function is integrated with the broader chromatin regulatory network in responding to topoisomerase I-mediated damage.

How does TDA7 contribute to genome stability during replication stress?

The potential role of TDA7 in maintaining genome stability during replication stress represents an important research direction that connects topoisomerase I function with DNA replication and repair mechanisms. Topoisomerase I is known to play crucial roles in relieving torsional stress during DNA replication , suggesting TDA7 may function at the intersection of topoisomerase activity and replication stress response.

Hypothesis Framework:

Topoisomerase I activity is particularly important during DNA replication when topological problems arise as the replication machinery progresses. If TDA7 is functionally related to topoisomerase I activity, it may:

  • Help resolve topoisomerase I-DNA complexes that become trapped during replication

  • Participate in replication fork protection or restart mechanisms

  • Facilitate repair of replication-associated DNA damage

  • Coordinate between replication and transcription to prevent collisions

Experimental Design:

  • Replication Stress Induction: Expose cells to hydroxyurea, aphidicolin, or low-dose MMS to induce replication stress, then analyze:

    • TDA7 localization changes using ChIP-seq or fluorescence microscopy

    • Genetic interactions between TDA7 and replication factors

    • Replication fork progression in TDA7 mutants using DNA fiber analysis

  • Replication Timing Analysis: Determine if TDA7 has preferences for early or late-replicating regions

  • Fork Protection Complex Interaction: Investigate interactions between TDA7 and known components of the replication fork protection complex

The following table represents potential phenotypes that could be observed in various genetic backgrounds under replication stress:

Genetic BackgroundNormal Growth+ Hydroxyurea+ Camptothecin+ HU and CPT
Wild-typeNormalModerate sensitivityModerate sensitivityHigh sensitivity
tda7ΔNormalHigh sensitivityHigh sensitivityExtreme sensitivity
top1ΔSlight defectModerate sensitivityResistantModerate sensitivity
tda7Δ top1ΔDefective???
tda7Δ + checkpoint mutant????

The question marks represent experimental outcomes that would be particularly informative about TDA7's role. For example, if the tda7Δ top1Δ double mutant shows rescue of the tda7Δ phenotype under certain conditions, this would suggest TDA7 functions to resolve toxic topoisomerase I intermediates.

This research direction would contribute significantly to understanding how cells maintain genome stability during DNA replication, particularly when facing challenges from topological stress or topoisomerase-targeting drugs like camptothecin .

What role might TDA7 play in transcription-associated genomic instability?

The potential involvement of TDA7 in transcription-associated genomic instability represents a fascinating research direction that connects several critical cellular processes. Since topoisomerase I is intimately involved in transcription by relieving torsional stress , and transcription can be a source of genomic instability, TDA7 may play a key role at this intersection.

Conceptual Framework:

Transcription generates positive supercoiling ahead of RNA polymerase and negative supercoiling behind it, creating topological challenges that require topoisomerase activity. Additionally, transcription-replication conflicts are major sources of genomic instability. As a topoisomerase I damage affected protein , TDA7 might:

  • Help resolve R-loops (RNA:DNA hybrids) that form during transcription

  • Participate in repair of transcription-associated DNA damage

  • Coordinate between transcription and replication to prevent conflicts

  • Function in transcription-coupled repair pathways

Research Methodology:

  • R-loop Analysis: Measure R-loop formation in TDA7-deficient cells using:

    • DNA:RNA immunoprecipitation (DRIP-seq)

    • S9.6 antibody staining for microscopy

    • Genetic interactions with factors known to prevent R-loops (e.g., RNase H, Sen1/Senataxin)

  • Transcription-Replication Conflict Assessment:

    • Analyze genomic regions where transcription and replication move in opposite directions

    • Map γH2AX accumulation to identify damage hotspots

    • Use proximity ligation assays to detect collisions between replication and transcription machinery

  • Genetic Interaction Studies:

    • Create double mutants with transcription elongation factors

    • Test genetic interactions with factors involved in transcription-coupled repair

A conceptual model of how TDA7 might function in different transcriptional contexts could be represented as follows:

Transcriptional ContextPotential TDA7 RolePredicted Phenotype in tda7ΔExperimental Approach
Highly transcribed genesPrevent R-loop formationIncreased R-loops and instabilityDRIP-seq, recombination assays
Genes with complex structureResolve topological challengesTranscription elongation defectsNET-seq, transcription run-on
Inducible genesFacilitate rapid transcriptional changesDelayed transcriptional responseTime-course RNA-seq
Convergent gene pairsPrevent transcriptional interferenceAltered transcript levels of adjacent genesDirectional RNA-seq

This research would build upon the established knowledge that transcription factors and the transcription machinery are critically important in S. cerevisiae and that specific mutations in topoisomerase I can lead to DNA damage, slow growth, and genomic instability . Understanding TDA7's role in this context could provide insights into fundamental mechanisms of genome maintenance during transcription.

Can TDA7 be used as a model for understanding novel DNA damage response factors in complex eukaryotes?

TDA7 presents a valuable opportunity to serve as a model for understanding novel DNA damage response factors in more complex eukaryotes. The study of TDA7 in S. cerevisiae can provide fundamental insights that may translate to higher organisms, following the established pattern where budding yeast has been at the forefront in discovering conserved mechanisms .

Translational Research Framework:

  • Conceptual Value as a Model System:

    • S. cerevisiae has demonstrated its value in elucidating basic mechanisms of transcription and DNA damage response

    • Many fundamental gene regulatory mechanisms are conserved across eukaryotes

    • The simplicity of yeast combined with powerful genetic tools allows rapid discovery of functions that can be later explored in complex systems

  • Research Approach for Translational Studies:

    • Identify conservation patterns of TDA7 across evolutionary distance

    • Create humanized yeast systems expressing homologs from higher eukaryotes

    • Develop predictive models of function based on yeast findings

    • Validate key findings in mammalian cell culture systems

Comparative Analysis Framework:

The following table illustrates how TDA7-related findings in yeast could be systematically translated to more complex systems:

Aspect of TDA7 BiologyYeast Discovery MethodTranslation to Complex EukaryotesPotential Medical Relevance
DNA damage response mechanismGenetic screens, phenotypic analysisIdentification of functional homologs via complementationCancer therapy resistance mechanisms
Protein interaction networkAP-MS, Y2H screeningConservation analysis of interaction partnersNovel drug targets in damage response pathways
Transcriptional regulationRNA-seq, ChIP-seqComparative genomics of regulatory elementsBiomarkers for therapeutic response
Post-translational modificationsMass spectrometryConservation of modification sites and enzymesDruggable regulatory mechanisms

Proof-of-Concept Experiments:

  • Identify potential human homologs or functional analogs of TDA7

  • Express these human proteins in TDA7-deficient yeast and assess functional complementation

  • Use CRISPR to knock out candidate genes in human cells and characterize resulting phenotypes

  • Compare DNA damage response pathways between yeast and human systems

This approach builds on the established precedent where yeast discoveries have led to significant advances in understanding human biology. For example, the discovery of mechanisms through which transcription activators and repressors affect transcriptional machinery in yeast has informed similar studies in higher eukaryotes . Similarly, the observation that the top1-103 mutation mimics the action of wild-type topoisomerase I in the presence of the anti-tumor drug camptothecin demonstrates how yeast findings can provide direct insights into cancer therapeutics.

What are the most promising future directions for TDA7 research in yeast and beyond?

Research on Topoisomerase I Damage Affected Protein 7 (TDA7) in yeast presents several promising future directions that could significantly enhance our understanding of DNA damage response mechanisms, genome stability maintenance, and potential applications in biomedical research.

The most promising research directions include:

  • Mechanistic Understanding of TDA7 Function: Elucidating the precise molecular mechanisms through which TDA7 responds to or mitigates topoisomerase I-mediated DNA damage represents a fundamental research priority. The observation that the top1-103 mutation in topoisomerase I causes phenotypes similar to camptothecin treatment provides a valuable framework for understanding how TDA7 might function in this context.

  • Integration with Chromatin Biology: Exploring the intersection between TDA7 function and chromatin regulation presents exciting opportunities, particularly given the established importance of histone deacetylases in transcriptional regulation in yeast . Investigating how histone modifications affect TDA7 activity could reveal novel regulatory mechanisms for DNA damage response factors.

  • Translational Research for Cancer Therapeutics: Since topoisomerase I is a target for anti-cancer drugs like camptothecin , understanding TDA7's role in cellular responses to topoisomerase I inhibition could provide insights into mechanisms of drug action and resistance. This could potentially lead to biomarker development or novel therapeutic strategies.

  • Systems-Level Network Analysis: Applying multi-omics approaches to position TDA7 within broader cellular networks would provide context for its function and potentially reveal unexpected connections to other cellular processes, following the pattern established in genomic research on S. cerevisiae .

  • Evolutionary Conservation Studies: Investigating potential functional homologs of TDA7 in higher eukaryotes could reveal conserved mechanisms of DNA damage response and potentially identify previously uncharacterized factors in human cells with relevance to disease.

The significance of these research directions extends beyond basic science into potential applications in biotechnology and medicine. As we continue to uncover the complex interplay between DNA topology, transcription, replication, and genome stability, TDA7 may emerge as an important model for understanding fundamental cellular processes with relevance to human health and disease.

How can collaborative approaches enhance our understanding of TDA7 and related proteins?

Collaborative, interdisciplinary approaches represent a powerful strategy for advancing our understanding of TDA7 and related proteins. By combining diverse expertise, methodologies, and perspectives, collaborative research can overcome technical limitations, generate comprehensive datasets, and develop integrative models that no single approach could achieve alone.

Effective Collaborative Frameworks:

  • Methodological Integration: Combining complementary experimental approaches provides multidimensional insights:

    • Structural biologists can determine TDA7's three-dimensional structure

    • Biochemists can characterize enzymatic activities and interactions

    • Geneticists can map functional networks through systematic screens

    • Computational biologists can integrate diverse datasets and develop predictive models

    • Cell biologists can analyze subcellular dynamics and responses to environmental changes

  • Cross-Species Collaboration: Studying TDA7-related proteins across multiple model organisms can reveal evolutionary conservation and specialization:

    • S. cerevisiae provides powerful genetic tools and fundamental insights

    • Schizosaccharomyces pombe offers complementary perspectives on cell cycle and repair

    • Mammalian cell culture systems allow testing of translational relevance

    • Model organisms like zebrafish or mice enable tissue-specific and developmental analyses

  • Technology-Driven Partnerships: Collaborations centered around cutting-edge technologies enable novel discoveries:

    • Single-cell approaches to capture heterogeneity in responses

    • Cryo-EM and X-ray crystallography for structural insights

    • Advanced imaging techniques for real-time analysis of DNA damage responses

    • CRISPR-based functional genomics for systematic characterization

  • Data-Sharing Infrastructure: Creating repositories and platforms for sharing TDA7-related data accelerates discovery:

    • Standardized protocols for generating comparable datasets

    • Public databases integrating multiple data types

    • Open-source analysis tools for collaborative interpretation

The power of collaborative approaches has been demonstrated in yeast research, where genome-wide methods have been used to analyze global expression and DNA binding by many transcription factors under varied growth conditions and in multiple yeast species . This type of comprehensive analysis would be particularly valuable for understanding the complex roles of TDA7 in cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.