Recombinant Saccharomyces cerevisiae Transmembrane E3 ubiquitin-protein ligase 1 (TUL1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant TUL1

Recombinant TUL1 is a full-length, 758-amino-acid transmembrane protein with a carboxy-terminal RING domain required for E3 ligase activity. Key features include:

PropertyDetails
SpeciesSaccharomyces cerevisiae (Baker’s yeast)
Expression HostEscherichia coli (E. coli)
TagN-terminal His-tag
Purity>90% (determined by SDS-PAGE)
FormLyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; addition of 5–50% glycerol recommended for long-term storage

The protein’s structure includes seven transmembrane helices and a luminal domain with glycosylation sites, critical for substrate recognition and membrane localization .

Functional Roles in Cellular Processes

TUL1 operates as part of the DSC ubiquitin ligase complex (Tul1, Dsc2, Dsc3, Ubx3) and regulates:

  • Protein Quality Control: Recognizes misfolded transmembrane domain (TMD)-containing proteins (e.g., polar residue-containing TMDs or unpalmitoylated SNAREs) for ubiquitination and vacuolar degradation via the multivesicular body (MVB) pathway .

  • Ubiquitination Pathways:

    • EGAD Pathway: Extracts substrates like Orm2 from Golgi membranes via CDC48 for proteasomal degradation .

    • MVB Sorting: Targets vacuolar proteins (e.g., Cps1, Phm5) for transport to the vacuole .

  • Proteostasis Maintenance: Required under non-stress conditions, as shown by quantitative diGly proteomics identifying 10 Tul1-dependent ubiquitylation sites .

Substrate Identification

  • diGly Proteomics: Identified 3116 ubiquitylation sites in S. cerevisiae, with Tul1-dependent substrates including Orm2 (a sphingolipid regulator) and vacuolar transporters .

  • Genetic Interactions: Tul1 is essential in cells lacking MVB pathways or under ubiquitin depletion, highlighting its backup role in proteostasis .

Complex Architecture

The DSC complex architecture parallels ERAD machinery but operates at the Golgi/endosome:

SubunitRole
Tul1Catalytic RING E3 ligase; binds E2 enzyme Ubc4
Dsc2/Dsc3Rhomboid-like pseudoproteases; substrate recognition
Ubx3Links Tul1 to CDC48 for substrate extraction

This complex cycles between Golgi, endosomes, and vacuoles via retromer/AP-3 trafficking .

Applications in Research

  • In Vitro Ubiquitination Assays: Used to study E3 ligase activity and substrate specificity .

  • Protein Trafficking Studies: Explores Golgi-to-vacuole sorting mechanisms using mutants (e.g., Pep12D) .

  • Therapeutic Target Screening: Mammalian homologs (RNF24, RNF122) implicated in neurodegenerative diseases .

Challenges and Future Directions

  • Substrate Diversity: Only artificial substrates (e.g., Pep12D) and a few native targets (Orm2) are confirmed; broader identification is needed .

  • Mammalian Homologs: Functional divergence complicates translation to human systems; RNF24/RNF122 lack Tul1’s luminal domain .

  • Mechanistic Insights: How Tul1 distinguishes between MVB and EGAD pathways remains unclear .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
TUL1; YKL034W; YKL247; Transmembrane E3 ubiquitin-protein ligase 1; RING-type E3 ubiquitin transferase TUL1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
TUL1
Target Protein Sequence
MEIDGNTLVFIIVILFLFFSSPGGDGVSSQYEFNQLQRLKQQFRTEHNTFVNMTYTDSFR NITGLKLSYQDMLNNPLQNATYPLPGKDYDRWFPNQNYMVLPNDVIEAINTEVWNTSNDD ASNLFPPNITSTLLGKIDLVSNNKYEKIRMPVPRFYEPATDFSEDIPPEGETYWSEWPSY GELHNVSFQHGEIAIQISHMSNLQDNNNYLRRNFINKKNDRWKLLNLQIDFSDKAEKEKH SIYSKAVYDIQRGRILSISQSSKFHSLFALPHYMSFQNDYNEKIFNDVKELVDEFWNFTD YTDVMTMKDVQDAYNNANFKCEYLIFLQLEPWNQYTRDQIKLIDDELNWPLGRPANLSSL PPINVVSGLLYSPDCGVRLGLHNVKGTRYELKIMSIRKHLLFGIALFAAQIYLLLTQMHH TNTPSMVNKISFYCFSMINLVDGSLATLYFVAASVVPELYLPLVISAFSCFILASIFEIR YLISIYASQVNEQNVGIINLLRGNTGTYDENRPRPAFIPDEGSIGGSLYGRFFFMLIIFT FLILSSTSWPRQLRMVFEYILIFILNSYWIPQIFRNAVKGIPSRRERARSSIGGNRSQNK MPLLWSFVIGTTIIRSLPVVYVFTYSSNVFRHHKDVHFVVFLSLWLLFQISILYSQDVLG SRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVDCAICMSDVPIYIEEIPETHKVD QHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPLPPL
Uniprot No.

Target Background

Function
This protein is the catalytic component of the DSC E3 ubiquitin ligase complexes, which tag proteins located in Golgi, endosome, and vacuole membranes. It plays a crucial role in protein homeostasis under non-stress conditions and contributes to protein quality control. This ligase mediates ubiquitination of vacuolar proteins such as CPS1, PPN1, PEP12, and other proteins containing exposed hydrophilic residues within their transmembrane domains. This process leads to their sorting into internal vesicles in late endosomes. It also targets the unpalmitoylated endosomal SNARE TLG1 to the MVB pathway.
Gene References Into Functions
  1. The Tul1 E3 ligase functions in protein homeostasis under non-stress conditions and supports a role in protein quality control. PMID: 25078903
Database Links

KEGG: sce:YKL034W

STRING: 4932.YKL034W

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the subunit architecture of the Saccharomyces cerevisiae TUL1 E3 ligase complex?

The Saccharomyces cerevisiae TUL1 E3 ligase complex consists of four essential subunits: Tul1, Dsc2, Dsc3, and Ubx3. Comprehensive biochemical analysis has demonstrated that all four subunits are required for the proper functioning of the complex in Golgi protein quality control. The Tul1 protein itself is an integral Golgi membrane protein characterized by a carboxy-terminal RING domain that interacts with the E2 ubiquitin-conjugating enzyme Ubc4. This interaction is critical for the ubiquitylation activity of the complex .

What are the known physiological functions of TUL1 in Saccharomyces cerevisiae?

TUL1 in Saccharomyces cerevisiae functions primarily in protein homeostasis (proteostasis) under non-stress conditions. Specifically, it plays crucial roles in:

  • Golgi protein quality control, targeting misfolded proteins for degradation

  • Ubiquitination and recycling of the exocytic v-SNARE Snc1 at the early endosome

  • Down-regulation of certain vacuole membrane proteins

  • Sorting of mutant proteins into the multivesicular body (MVB) pathway

  • Protein quality control when the MVB degradation pathway is compromised

What experimental approaches are typically used to study TUL1 function in yeast?

To study TUL1 function in Saccharomyces cerevisiae, researchers typically employ the following experimental approaches:

  • Genetic manipulation techniques:

    • Creation of tul1Δ deletion strains

    • Generation of mutations in specific domains

    • Construction of double mutants lacking both TUL1 and components of the MVB pathway

  • Proteomics approaches:

    • Quantitative diGly proteomics using SILAC (Stable Isotope Labeling by Amino acids in Cell culture)

    • Comparative proteome analysis between wild-type and tul1Δ cells

  • Microscopy-based techniques:

    • Fluorescence microscopy to track protein localization

    • Live-cell imaging to monitor protein trafficking

  • Biochemical assays:

    • In vitro ubiquitylation assays

    • Co-immunoprecipitation to study protein-protein interactions

    • Western blotting to detect ubiquitylated substrates

Each method provides distinct insights into TUL1's role in cellular processes, with the combination of multiple approaches yielding the most comprehensive understanding.

How can researchers design experiments to identify novel TUL1 substrates beyond the known targets Pep12D and unpalmitoylated Tlg1?

Designing experiments to identify novel TUL1 substrates requires a systematic approach combining multiple methods:

  • Quantitative diGly proteomics:

    • Compare ubiquitylation patterns between wild-type and tul1Δ strains using SILAC

    • Normalize data against protein abundance changes detected by quantitative proteomics

    • Focus on proteins with decreased ubiquitylation in tul1Δ strains

  • Stress condition screening:

    • Subject cells to various stress conditions (heat shock, oxidative stress, ER stress)

    • Monitor changes in the TUL1-dependent ubiquitylome under each condition

    • Identify condition-specific substrates

  • Subcellular fractionation:

    • Isolate Golgi and endosomal compartments

    • Analyze the ubiquitylation status of proteins in these fractions

    • Compare results between wild-type and tul1Δ strains

  • Candidate approach validation:

    • For potential substrates identified in screens, analyze:

      • Direct interaction with TUL1 complex components

      • Ubiquitylation status in vitro

      • Trafficking patterns in tul1Δ vs. wild-type cells

      • Half-life differences in tul1Δ vs. wild-type cells

This multi-faceted approach maximizes the likelihood of identifying physiologically relevant substrates while minimizing false positives.

What methodological considerations are important when analyzing TUL1-dependent ubiquitylation using diGly proteomics?

When analyzing TUL1-dependent ubiquitylation using diGly proteomics, researchers should consider several critical methodological factors:

  • Protein abundance normalization:

    • Perform parallel quantitative proteomics to correct for changes in protein expression

    • This is essential as 4.5% of quantified proteins (53/1172) show differential expression in tul1Δ cells

    • Failure to normalize can lead to misidentification of ubiquitylation sites as TUL1-dependent

  • Statistical analysis:

    • Implement robust statistical methods to determine significance thresholds

    • Consider multiple hypothesis testing corrections

    • Validate findings with technical and biological replicates

  • Controls and sample preparation:

    • Include appropriate controls (e.g., catalytically inactive TUL1 mutants)

    • Ensure complete protein extraction, particularly for membrane proteins

    • Optimize trypsin digestion conditions for maximum diGly peptide recovery

  • Data interpretation:

    • Consider indirect effects of TUL1 deletion on other E3 ligases

    • Distinguish between direct TUL1 substrates and secondary effects

    • Cross-reference with protein localization data

  • Validation experiments:

    • Design follow-up experiments for candidate substrates

    • Consider site-directed mutagenesis of identified ubiquitylation sites

    • Perform functional assays to confirm the biological relevance

This methodological framework enhances the reliability and interpretability of diGly proteomics data for identifying authentic TUL1 substrates.

How does the localization of TUL1 to the Golgi reconcile with its role in regulating vacuolar membrane proteins?

The apparent contradiction between TUL1's Golgi localization and its role in regulating vacuolar membrane proteins can be explained through several potential mechanisms:

  • Protein trafficking intersections:

    • TUL1 may act on substrates during their transit through the Golgi en route to the vacuole

    • Ubiquitylation at the Golgi could serve as a "mark" for later sorting decisions

  • Dynamic localization:

    • TUL1 might not be exclusively Golgi-localized but could cycle between compartments

    • Small populations of TUL1 might exist at endosomes or other compartments

  • Substrate recycling pathways:

    • Vacuolar membrane proteins can recycle through the endosomal system and Golgi

    • TUL1 could encounter these proteins during recycling

  • Multi-compartment protein quality control network:

    • TUL1 may be part of a broader quality control network spanning multiple organelles

    • Communication between different E3 ligases could coordinate substrate processing

  • Indirect regulation:

    • TUL1 could regulate other factors that directly control vacuolar protein degradation

    • Cascades of ubiquitylation events might link Golgi and vacuolar processes

This question remains an active area of research, with recent work suggesting that TUL1 participation in early endosomal processes (such as Snc1 recycling) might provide clues to resolving this apparent contradiction.

What are the key considerations when designing experiments to study TUL1 function in protein quality control?

When designing experiments to study TUL1 function in protein quality control, researchers should consider these key factors:

  • Define research variables:

    • Independent variable: TUL1 status (wild-type, deletion, domain mutations)

    • Dependent variables: Substrate ubiquitylation, localization, degradation rates

    • Control variables: Growth conditions, expression levels of substrates

  • Generate specific hypotheses:

    • Formulate testable predictions about TUL1's role in specific quality control pathways

    • Consider alternative hypotheses that could explain observed phenotypes

  • Design appropriate treatments:

    • Create genetic manipulations (gene deletions, point mutations)

    • Apply stress conditions that might require TUL1 function

    • Use chemical inhibitors of related pathways

  • Establish experimental groups:

    • Include all necessary controls (positive, negative, vehicle)

    • Consider using within-subject designs where appropriate

    • Ensure sufficient biological replicates

  • Plan measurement approaches:

    • Select methods appropriate for detecting ubiquitylation (Western blots, mass spectrometry)

    • Choose appropriate time points for dynamic processes

    • Develop quantitative readouts when possible

What methods can be used to validate potential TUL1 substrates identified through proteomics approaches?

To validate potential TUL1 substrates identified through proteomics approaches, researchers should implement a multi-layered validation strategy:

  • In vivo ubiquitylation analysis:

    • Immunoprecipitate candidate substrates and blot for ubiquitin

    • Compare ubiquitylation patterns in wild-type versus tul1Δ cells

    • Use lysine-to-arginine mutations at suspected ubiquitylation sites

  • Direct interaction studies:

    • Perform co-immunoprecipitation between TUL1 complex components and candidate substrates

    • Use yeast two-hybrid or split-ubiquitin assays for membrane proteins

    • Conduct in vitro binding assays with purified components

  • Localization and trafficking analysis:

    • Track substrate localization using fluorescent protein fusions

    • Compare trafficking patterns in wild-type versus tul1Δ backgrounds

    • Analyze co-localization with TUL1 complex components

  • Stability and turnover measurements:

    • Perform cycloheximide chase experiments to measure protein half-life

    • Compare degradation rates in wild-type versus tul1Δ strains

    • Analyze the impact of proteasome or vacuolar degradation inhibitors

  • Reconstitution experiments:

    • Express TUL1 in tul1Δ cells and assess restoration of substrate ubiquitylation

    • Test the effect of catalytically inactive TUL1 mutants

    • Examine the requirement for other TUL1 complex components

This comprehensive validation approach helps distinguish genuine TUL1 substrates from false positives that may appear in proteomics datasets.

How should researchers interpret contradictory data regarding TUL1 localization and function?

When faced with contradictory data regarding TUL1 localization and function, researchers should adopt a systematic analytical approach:

  • Reconcile localization discrepancies:

    StudyReported LocalizationExperimental MethodPotential Explanation
    Primary literatureGolgi apparatusImmunofluorescence, GFP taggingPredominant steady-state location
    Recent studiesEarly endosome functionFunctional assays with Snc1Dynamic population or indirect effects
    FLY1 homolog studiesLate endosomeSubcellular fractionationSpecies-specific differences
  • Consider technical limitations:

    • Evaluate how protein tagging might affect localization

    • Assess fixation methods that could distort membrane structures

    • Review expression levels that might cause mislocalization

  • Explore biological explanations:

    • TUL1 may shuttle between compartments

    • Distinct pools might exist in different locations

    • TUL1 might function through intermediate factors

  • Design clarifying experiments:

    • Use super-resolution microscopy for precise localization

    • Perform time-resolved imaging to capture dynamic behavior

    • Conduct organelle-specific activity assays

  • Integrate multiple data types:

    • Combine imaging, biochemical, and genetic approaches

    • Consider how different experimental conditions might affect results

    • Look for consensus findings across studies

Contradictions in scientific data often highlight opportunities for new discoveries about complex biological mechanisms, particularly for dynamic membrane-associated proteins like TUL1.

What statistical approaches are most appropriate for analyzing quantitative diGly proteomics data to identify TUL1 substrates?

When analyzing quantitative diGly proteomics data to identify TUL1 substrates, the following statistical approaches are most appropriate:

  • Normalization strategies:

    • Account for protein abundance changes using parallel proteomics data

    • Apply robust normalization methods to correct for technical variations

    • Consider site-specific normalization for proteins with multiple ubiquitylation sites

  • Significance testing:

    • Implement moderated t-tests with multiple testing correction

    • Use LIMMA (Linear Models for Microarray Data) for improved variance estimation

    • Consider Significance Analysis of Microarrays (SAM) for robust fold-change detection

  • Data visualization:

    • Generate volcano plots highlighting significant changes

    • Create heatmaps for pattern recognition across multiple conditions

    • Use scatter plots to visualize the relationship between protein abundance and ubiquitylation changes

  • Classification and cutoff strategies:

    Analysis TypeRecommended CutoffsRationale
    Primary screenp < 0.05, fold change > 1.5Capture potential hits with reasonable sensitivity
    High-confidence setp < 0.01, fold change > 2.0Focus on strongest candidates for validation
    Context-specificVaried by compartment/pathwayRecognize that different substrates may show different magnitudes of change
  • Integrated analysis approaches:

    • Combine ubiquitylation data with protein localization information

    • Incorporate known protein-protein interaction networks

    • Apply pathway enrichment analysis to identify biological processes affected by TUL1

These statistical methods help distinguish genuine TUL1-dependent ubiquitylation events from background variations, while accounting for confounding factors such as changes in protein abundance.

How might the study of TUL1 inform our understanding of protein quality control across different cellular compartments?

The study of TUL1 provides valuable insights into protein quality control across cellular compartments:

  • Integration of multi-organelle quality control:

    • TUL1's role in both Golgi and endosomal processes suggests cross-compartment coordination

    • The relationship between TUL1 and the MVB pathway illustrates how sequential quality control mechanisms maintain proteostasis

    • Understanding TUL1 function helps map the "handoffs" between compartment-specific degradation mechanisms

  • Substrate specificity determinants:

    • Analysis of TUL1 substrates reveals molecular features that trigger quality control in different compartments

    • The recognition of transmembrane domain defects (as in Pep12D) informs models of membrane protein surveillance

    • Comparison with ERAD substrates highlights compartment-specific versus universal quality control signals

  • Coordination with other cellular pathways:

    • TUL1's relationship with the ubiquitin-proteasome system and MVB pathway demonstrates interconnected degradation networks

    • Genetic interactions between TUL1 and other quality control factors reveal compensatory mechanisms

    • TUL1's role under conditions of ubiquitin depletion highlights stress-responsive adaptation of quality control systems

These insights contribute to developing an integrated model of cellular protein quality control that spans from biosynthesis through trafficking to eventual degradation.

What are the most promising directions for future research on TUL1 and related E3 ligase complexes?

The most promising directions for future TUL1 research include:

  • Comprehensive substrate identification:

    • Apply advanced proteomics to identify the complete set of physiological TUL1 substrates

    • Determine how substrate specificity is achieved at the molecular level

    • Map the features that distinguish TUL1 substrates from those of other E3 ligases

  • Structural biology approaches:

    • Determine the three-dimensional structure of the TUL1 complex

    • Analyze how substrate binding induces conformational changes

    • Elucidate the molecular basis of E2-E3 interactions in this system

  • Dynamic regulation studies:

    • Investigate how TUL1 activity is regulated under different cellular conditions

    • Explore potential post-translational modifications of TUL1 complex components

    • Examine the assembly and disassembly dynamics of the complex

  • Comparative analysis across species:

    • Compare TUL1 function with homologs in other organisms (e.g., FLY1)

    • Investigate how the roles of these E3 ligases have evolved

    • Identify conserved versus species-specific functions

  • Therapeutic relevance exploration:

    • Investigate connections between TUL1 homologs and human disease

    • Explore the potential of targeting similar quality control mechanisms in pathological conditions

    • Develop model systems for studying conserved aspects of these pathways

These research directions would significantly advance our understanding of protein quality control mechanisms while potentially revealing new therapeutic targets for diseases involving protein misfolding and aggregation.

What are common technical challenges in studying TUL1 function, and how can researchers address them?

Researchers studying TUL1 face several technical challenges that can be addressed with specific strategies:

  • Membrane protein manipulation difficulties:

    ChallengeSolution Strategy
    Poor extraction efficiencyUse specialized detergents (digitonin, DDM) optimized for membrane proteins
    Protein aggregation during purificationInclude stabilizing agents; purify at lower temperatures
    Non-specific interactionsImplement stringent washing conditions; validate with multiple methods
  • Visualizing low-abundance ubiquitylation events:

    • Enrich ubiquitylated proteins using tandem ubiquitin-binding entities (TUBEs)

    • Apply targeted mass spectrometry approaches for greater sensitivity

    • Use ubiquitin remnant antibodies to improve detection of modified peptides

  • Distinguishing direct from indirect effects:

    • Design time-course experiments to capture primary versus secondary effects

    • Implement acute inactivation systems (e.g., auxin-inducible degrons) for TUL1

    • Create separation-of-function mutants that affect specific aspects of TUL1 activity

  • Reconstituting complex in vitro systems:

    • Develop co-expression systems for the complete TUL1 complex

    • Use membrane mimetics (nanodiscs, liposomes) to maintain native conformation

    • Establish cell-free assays that preserve the native membrane environment

By implementing these approaches, researchers can overcome the intrinsic difficulties in studying membrane-associated E3 ligase complexes like TUL1.

How can researchers resolve contradictory findings regarding TUL1 substrate specificity in different experimental systems?

To resolve contradictory findings regarding TUL1 substrate specificity across different experimental systems, researchers should:

  • Standardize experimental conditions:

    • Establish consensus protocols for cell growth, lysis, and assay conditions

    • Control expression levels of both TUL1 and candidate substrates

    • Document strain background details that might influence results

  • Directly compare methodologies:

    • Conduct side-by-side experiments using different techniques on the same biological samples

    • Implement both in vivo and in vitro approaches to validate findings

    • Create a controlled variable matrix to identify factors causing discrepancies

  • Develop integrated validation criteria:

    Validation CriterionImplementationSignificance
    Direct interactionCo-immunoprecipitation, proximity labelingEstablishes physical association
    Ubiquitylation dependencySite-directed mutagenesis of target lysinesConfirms specific modification sites
    In vitro reconstitutionPurified components ubiquitylation assayDemonstrates direct activity
    Physiological relevancePhenotypic analysis of substrate mutationsLinks biochemistry to function
  • Address context-dependent factors:

    • Investigate how cellular conditions affect substrate recognition

    • Examine whether post-translational modifications influence specificity

    • Consider protein complex formation that might alter substrate availability

  • Collaborative cross-laboratory validation:

    • Establish round-robin testing of key findings

    • Share reagents and detailed protocols between research groups

    • Develop consensus positive and negative controls

Through this systematic approach, the field can develop a more coherent understanding of TUL1 substrate specificity that reconciles seemingly contradictory findings from different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.