Recombinant Saccharomyces cerevisiae Truncated non-functional calcium-binding mitochondrial carrier SAL1-1 (SAL1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mitochondria

The native SAL1 protein is a mitochondrial inner membrane carrier involved in calcium-dependent nucleotide transport. Key findings from studies include:

Calcium Dependency

  • SAL1 binds Ca²⁺ via two N-terminal EF-hand motifs, a feature critical for its transport activity .

  • Recombinant SAL1 lacks functional Ca²⁺ binding due to truncation but retains structural motifs for experimental studies .

Nucleotide Transport

  • SAL1 facilitates ATP-Mg²⁺/phosphate (Pi) exchange in a Ca²⁺-dependent manner, with a Kₘ of 0.20 mM for ATP-Mg²⁺ and 0.28 mM for ADP .

  • In S. cerevisiae, SAL1 compensates for the loss of ATP/ADP translocase (Aac2p) by maintaining mitochondrial ATP pools, essential for viability .

Genetic Interactions

  • Disruption of SAL1 is synthetically lethal with AAC2 mutations, highlighting their overlapping roles in mitochondrial nucleotide homeostasis .

  • SAL1 supports mitochondrial DNA stability and translation, particularly under stress conditions .

Research Applications

Recombinant SAL1 is primarily used to investigate mitochondrial carrier mechanisms and calcium signaling. Notable applications include:

ATP Transport Assays

  • Studies using mitochondrially targeted luciferase demonstrated SAL1's role in ATP-Mg²⁺ uptake under Ca²⁺ activation .

  • Transport kinetics were quantified in isolated mitochondria, revealing strict Ca²⁺ dependency (S₀.₅ = 15 μM) .

Protein Interaction Studies

  • SAL1’s synthetic lethality with AAC2 has been leveraged to dissect functional redundancies in nucleotide transport pathways .

  • Antibodies against SAL1 (e.g., Rabbit anti-SAL1 polyclonal IgG) enable localization and topology studies via Western blot and ELISA .

Comparative Analysis of SAL1 Variants

FeatureNative SAL1Recombinant Truncated SAL1
Calcium BindingFunctional (EF-hand motifs intact) Non-functional (truncated domain)
Transport ActivityActive ATP-Mg²⁺/Pi exchange Inactive due to truncation
Research UtilityMechanistic studies in vivoStructural analysis, antibody production

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
SAL1; YNL083W; N2312; Truncated non-functional calcium-binding mitochondrial carrier SAL1-1; Suppressor of AAC2 lethality
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SAL1
Target Protein Sequence
MLLKNCETDKQRDIRYACLFKELDVKGNGQVTLDNLISAFEKNDHPLKGNDEAIKMLFTA MDVNKDSVVDLSDFKKYASNAESQIWNGFQRIDLDHDGKIGINEINRYLSDLDNQSICNN ELNHELSNEKVNKFSRFFEWAFPKRKANIALRGQASHKKNTDNDRSKKTTDSDLYVTYDQ WRDFLLLVPRKQGSRLHTAYSYFYLFNEDVDLSSEGDVTLINDFIRGFGFFIAGGISGVI SRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAVKSLYRQGG IKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMA AQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGGQIILQRCHSRYSGHISL CCIRFGDFFCLKKMVYCQTGKDPEPTTRSGHSKQPGCTSNGCIQWNCRSFCCLSNQSFKN KTTSPRNICTSLCV
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier.
Gene References Into Functions
  1. The transport activity of Sal1 and its sensitivity to a glucose-induced calcium signal are presented. PMID: 16111475
  2. Growth on glucose requires ATP hydrolysis in mitochondria and recruits Sal1p as a Ca2+-dependent mechanism to import ATP-Mg from the cytosol. PMID: 18485069
Database Links

KEGG: sce:YNL083W

STRING: 4932.YNL083W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SAL1 in Saccharomyces cerevisiae?

SAL1 functions as a calcium-dependent carrier protein that transports adenine nucleotides across the mitochondrial membrane. Its primary role appears to be maintaining the essential intramitochondrial ATP pool required for both mitochondrial proliferation and cell growth. While the mitochondrial ADP/ATP carrier (Aac2p) predominantly functions in ADP/ATP exchange between the cytosol and mitochondria, SAL1 provides an alternative pathway for adenine nucleotide transport. This function becomes critically important when the conventional ADP/ATP exchange mechanism is compromised. Research suggests that SAL1 likely catalyzes ATP-Mg/Pi exchange rather than the direct ADP/ATP exchange performed by Aac2p .

To investigate the function of SAL1 experimentally, researchers have employed genetic approaches (gene deletion, mutation analysis) combined with physiological assays that measure mitochondrial ATP uptake and ATPase activity. Kinetic analysis of ATPase activity in isolated mitochondria from both wild-type and Δsal1 strains has revealed that SAL1 deletion significantly alters the enzyme's kinetic parameters, reducing both its maximum velocity (Vmax) and affinity for ATP .

How does calcium binding affect SAL1 function?

SAL1 contains two EF-hand motifs located at its amino terminus that bind calcium ions. This calcium binding is not merely a structural feature but is essential for the protein's suppressor activity. When SAL1 binds calcium through these EF-hand motifs, it undergoes a conformational change that enables its adenine nucleotide transport function .

To study the calcium dependency of SAL1, researchers can employ site-directed mutagenesis targeting the EF-hand motifs and assess the resulting phenotypes. Additionally, transport assays in the presence or absence of calcium can directly demonstrate how calcium availability affects SAL1's carrier activity. A methodological approach might involve purifying recombinant SAL1 protein with intact or mutated EF-hand domains, followed by calcium binding assays using isothermal titration calorimetry or fluorescence spectroscopy to quantify binding affinity and stoichiometry .

What distinguishes the truncated non-functional SAL1-1 variant from wild-type SAL1?

The truncated non-functional calcium-binding mitochondrial carrier SAL1-1 variant lacks certain regions of the full-length protein that are essential for its proper function. While the search results don't provide complete details on the exact truncation points, the non-functional variant appears to retain the calcium-binding domains but lacks functional carrier activity .

For experimental characterization of SAL1-1, researchers typically employ recombinant expression systems to produce the truncated protein, followed by functional assays comparing its activity to the wild-type version. These assays might include:

  • Adenine nucleotide transport assays using reconstituted liposomes

  • Calcium binding assays to determine if binding affinity is altered

  • Yeast complementation experiments to assess whether SAL1-1 can suppress aac2 lethality

  • Structural studies using techniques like X-ray crystallography or cryo-electron microscopy to identify conformational differences

How does SAL1 compensate for the essential function of the ADP/ATP carrier (Aac2p)?

SAL1 compensates for Aac2p deficiency through an alternative adenine nucleotide transport mechanism that maintains the essential mitochondrial ATP pool. Unlike the typical ADP/ATP exchange mediated by Aac2p, SAL1 appears to function through a different operational mode, possibly as an ATP-Mg/Pi exchanger. This functional redundancy becomes critical under conditions where ADP/ATP exchange transport is compromised either by genetic deletion of AAC2 or through chemical inhibition with compounds like bongkrekic acid (BKA) .

To investigate this compensatory mechanism, researchers can employ the following methodological approaches:

  • Genetic studies: Creating double mutants (Δsal1Δaac2) reveals synthetic lethality, indicating that both proteins share an essential function.

  • Inhibitor studies: Treatment with BKA, which blocks ADP/ATP exchange transport in intact cells, demonstrates that cells with functional SAL1 can grow despite inhibition of AAC-mediated transport.

  • ATP transport assays: Using isolated mitochondria from various genetic backgrounds (wild-type, Δsal1, Δaac2, Δaac2Δaac3) to measure ATP uptake rates in the presence or absence of inhibitors.

Strain BackgroundATP Transport Rate (% of WT)Growth on Glucose MediaGrowth with BKA (0.125 μM)
Wild-type100%NormalNormal
Δsal1ReducedNormalInhibited
Δaac2ReducedDelayedNormal
Δaac2Δaac3Significantly reducedSignificantly delayedNormal
Δsal1Δaac2Not viableNot viableNot viable

The experimental data demonstrate that SAL1 provides sufficient adenine nucleotide transport to maintain cell viability when AAC-mediated transport is compromised, but this alternative pathway is not efficient enough to support optimal growth rates .

What are the molecular mechanisms behind the synthetic lethality of Δsal1Δaac2 double mutants?

The synthetic lethality observed in Δsal1Δaac2 double mutants stems from the complete disruption of adenine nucleotide transport into mitochondria, preventing the maintenance of the essential mitochondrial ATP pool. This lethality occurs under both aerobic and anaerobic conditions, indicating that the essential function is independent of oxidative phosphorylation .

The molecular mechanisms can be investigated through:

  • Metabolomic profiling: Comparing ATP, ADP, and AMP levels in mitochondrial and cytosolic fractions from various genetic backgrounds to identify specific metabolic defects.

  • Suppressor screens: Identifying genes that, when overexpressed, can rescue the Δsal1Δaac2 synthetic lethality, potentially revealing additional components of adenine nucleotide transport pathways.

  • Conditional mutants: Using temperature-sensitive or chemically-inducible systems to create conditional Δsal1Δaac2 mutants and monitor early cellular responses before lethality.

  • Structural biology approaches: Determining how SAL1 and Aac2p differ in their transport mechanisms through structural studies of both proteins.

The research suggests that the essential function (V function) of Aac2p that can be complemented by SAL1 is distinct from its role in ADP/ATP exchange (R function). The V function likely involves the net import of adenine nucleotides into mitochondria rather than the exchange transport that maintains the adenine nucleotide balance during respiration .

How do experimental conditions affect SAL1 function and its ability to compensate for Aac2p deficiency?

Methodological approaches to study condition-dependent effects include:

  • Growth assays under various carbon sources: Testing growth on fermentable (glucose) versus non-fermentable (glycerol, ethanol) carbon sources to distinguish between conditions requiring R function versus V function.

  • Mitochondrial isolation under different growth conditions: Analyzing SAL1-dependent transport activity in mitochondria isolated from cells grown under different metabolic states.

  • Inhibitor titration experiments: Using varying concentrations of BKA to create a spectrum of Aac2p inhibition and measure the corresponding SAL1-dependent compensation.

Carbon SourceΔaac2 GrowthΔsal1 GrowthΔaac2Δsal1 GrowthWild-type + BKAΔsal1 + BKA
Glucose (2%)DelayedNormalNot viableNormalInhibited
Glucose (8%)Significantly delayedNormalNot viableNormalInhibited
GlycerolNot viableNormalNot viableNot viableNot viable

These experimental results demonstrate that SAL1's compensatory function is specific to fermentative growth conditions and cannot replace the R function of Aac2p required for respiratory growth .

What structural features of SAL1 determine its calcium-dependent carrier activity?

SAL1 belongs to the mitochondrial carrier family but possesses unique structural features that distinguish it from other family members, most notably the calcium-binding EF-hand motifs located at its amino terminus. These structural elements play a crucial role in determining SAL1's functional properties and regulation .

The key structural features include:

  • EF-hand calcium-binding domains: Located at the N-terminus, these motifs bind calcium ions with high affinity, triggering conformational changes that regulate carrier activity.

  • Transmembrane domains: Like other mitochondrial carriers, SAL1 contains multiple transmembrane segments that form the channel through which adenine nucleotides are transported.

  • Substrate binding sites: Specific residues within the transmembrane regions form the binding site for adenine nucleotides, with potentially different specificity compared to Aac2p.

To investigate these structural determinants, researchers can employ:

  • Domain swapping experiments: Creating chimeric proteins between SAL1 and other mitochondrial carriers to identify regions responsible for specific functional properties.

  • Site-directed mutagenesis: Targeting conserved residues within the putative substrate binding sites or transmembrane domains to alter transport specificity or activity.

  • Structural biology approaches: X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of SAL1 in different conformational states (calcium-bound versus calcium-free).

  • Computational modeling: Using homology modeling based on known structures of other mitochondrial carriers (like the ADP/ATP carrier) to predict structural features unique to SAL1.

SAL1 appears to be evolutionarily related to other calcium-binding mitochondrial carriers like citrin and aralar1, which function as aspartate/glutamate transporters . Understanding the structural basis for different substrate specificities among these related carriers could provide insights into SAL1's unique properties.

How can recombinant SAL1 and SAL1-1 be optimally expressed and purified for structural and functional studies?

The expression and purification of recombinant SAL1 and its truncated variant SAL1-1 present significant challenges due to their membrane protein nature and calcium-binding properties. A comprehensive purification strategy should be designed to obtain functionally active protein suitable for structural and biochemical analyses.

Methodological approach:

  • Expression system selection:

    • Escherichia coli: While commonly used for recombinant protein expression, bacterial systems often struggle with proper folding of eukaryotic membrane proteins.

    • Saccharomyces cerevisiae: Homologous expression provides the native cellular environment, potentially yielding correctly folded protein.

    • Pichia pastoris: This yeast system combines high expression levels with eukaryotic post-translational modifications.

    • Insect cell/baculovirus system: Offers advantages for membrane protein expression with higher yields than yeast.

  • Construct design considerations:

    • Addition of affinity tags (His, FLAG, or GST) for purification

    • Inclusion of a cleavable signal sequence for proper membrane targeting

    • For SAL1-1, precise determination of truncation points based on domain prediction

    • Codon optimization for the chosen expression system

  • Solubilization and purification strategy:

    • Screen detergents (DDM, LMNG, digitonin) for optimal solubilization

    • Employ calcium-dependent purification techniques leveraging the EF-hand domains

    • Consider nanodisc or liposome reconstitution for functional studies

  • Quality control assessments:

    • Size-exclusion chromatography to verify monodispersity

    • Circular dichroism to assess secondary structure

    • Calcium binding assays to confirm functional EF-hand domains

    • Transport assays in proteoliposomes to verify carrier activity

By systematically optimizing these conditions, researchers can obtain pure, functional SAL1 and SAL1-1 proteins suitable for comparative structural and functional analyses .

What experimental approaches can resolve the apparent paradox of adenine nucleotide net import via AAC carriers?

The research presents an interesting paradox: while the ADP/ATP carrier (Aac2p) operates through a strict exchange mechanism with a single binding site alternating between matrix and intermembrane space orientations, both SAL1 and Aac2p appear capable of net adenine nucleotide import into mitochondria. This represents a fundamental question about the operational modes of these carriers .

Experimental approaches to address this paradox:

  • Reconstituted transport systems:

    • Purify Aac2p and SAL1 and reconstitute into liposomes

    • Load liposomes with different internal substrates

    • Measure net versus exchange transport under various conditions

    • Test the hypothesis that Aac2p might transport alternative substrates in exchange for adenine nucleotides

  • Metabolic labeling experiments:

    • Use isotopically labeled adenine nucleotides to track their movement

    • Distinguish between net import versus recycling of nucleotides

    • Measure under conditions where either SAL1 or Aac2p is active

  • Structure-function analysis:

    • Identify key residues that might allow Aac2p to transport alternative substrates

    • Create mutations that enhance or abolish the proposed V function

    • Test these mutants for their ability to support cell viability

  • Alternative substrate identification:

    • Screen for potential non-adenine nucleotide substrates of Aac2p

    • Use techniques like metabolomics to identify molecules that change in abundance when the V function is active

    • Test candidate molecules in transport assays

The search results suggest that for net nucleotide transport, Aac2p might transport other substrates in exchange for adenine nucleotides. One hypothesis is that Aac2p could export fatty acid anions from mitochondria in exchange for adenine nucleotides, as it has been reported to transport substrates other than ADP/ATP in a BKA-sensitive manner .

How can genome-wide screens be utilized to identify additional factors involved in SAL1 function and regulation?

Genome-wide screening approaches can provide comprehensive insights into the genetic networks surrounding SAL1 function and regulation. These unbiased approaches can reveal unexpected connections and identify novel factors involved in mitochondrial adenine nucleotide homeostasis.

Methodological framework:

  • Synthetic genetic array (SGA) analysis:

    • Cross Δsal1 mutants with the yeast deletion collection

    • Identify synthetic lethal, sick, or suppressor interactions

    • Focus on interactions that are specific to Δsal1 but not shared with Δaac2

    • This approach can reveal parallel pathways or regulatory components

  • High-throughput suppressor screens:

    • Transform Δsal1Δaac2 double mutants (maintained with a plasmid-borne copy of either gene) with genomic or cDNA libraries

    • Identify genes that, when overexpressed, can suppress the synthetic lethality

    • Categorize suppressors based on functional categories and cellular localization

  • CRISPR-based screens:

    • Apply CRISPR interference or activation libraries in S. cerevisiae

    • Screen for altered growth phenotypes in backgrounds with compromised SAL1 or AAC function

    • This approach can identify both negative and positive regulators

  • Proteomic interaction mapping:

    • Perform BioID or proximity labeling with SAL1 as bait

    • Identify proteins that physically interact with or are in close proximity to SAL1

    • Compare interactomes under different calcium concentrations or metabolic conditions

  • Transcriptomic profiling:

    • Compare gene expression patterns between wild-type, Δsal1, Δaac2, and conditional Δsal1Δaac2 strains

    • Identify compensatory transcriptional responses

    • Look for coordination with calcium signaling pathways

These comprehensive screening approaches can generate testable hypotheses about SAL1 regulation and function, potentially identifying new therapeutic targets for mitochondrial disorders related to adenine nucleotide transport defects .

How does SAL1 function compare to other calcium-binding mitochondrial carriers like citrin and aralar1?

SAL1 belongs to a subset of mitochondrial carriers that contain calcium-binding EF-hand motifs, a group that also includes citrin and aralar1. While these proteins share structural similarities, they transport different substrates and serve distinct physiological functions. Understanding the similarities and differences between these calcium-regulated carriers provides insights into their specialized roles and evolutionary relationships .

Comparative analysis framework:

FeatureSAL1CitrinAralar1
SubstrateAdenine nucleotidesAspartate/glutamateAspartate/glutamate
Calcium binding motifsTwo EF-hands at N-terminusMultiple EF-handsMultiple EF-hands
Tissue distribution in mammalsN/A (yeast protein)Liver-specificBrain and muscle
Associated pathologiesNone identifiedCitrin deficiency, citrullinemia type IINot fully established
Metabolic roleMaintains mitochondrial adenine nucleotide poolComponent of malate-aspartate shuttleComponent of malate-aspartate shuttle

Methodological approaches for comparative studies:

  • Sequence and structural analysis:

    • Alignment of calcium-binding domains to identify conserved features

    • Phylogenetic analysis to trace evolutionary relationships

    • Homology modeling to predict structural similarities and differences

  • Domain swapping experiments:

    • Create chimeric proteins with exchanged calcium-binding domains

    • Test whether calcium regulation is transferable between carriers

  • Heterologous expression studies:

    • Express human citrin or aralar1 in Δsal1Δaac2 yeast

    • Determine if these mammalian carriers can complement the synthetic lethality

  • Calcium responsiveness comparison:

    • Measure transport activities at different calcium concentrations

    • Compare calcium binding affinities and cooperativity

    • Assess structural changes upon calcium binding

Understanding the mechanistic similarities and differences between these calcium-regulated carriers could provide insights into the evolution of specialized transport functions and potentially inform therapeutic approaches for diseases associated with carrier deficiencies .

What are the functional differences between wild-type SAL1 and the truncated SAL1-1 variant at the molecular level?

Understanding the molecular basis for the functional differences between wild-type SAL1 and the truncated SAL1-1 variant requires detailed biochemical and structural characterization. These differences can provide insights into structure-function relationships and potential regulatory mechanisms.

Methodological approaches:

  • Comparative structural analysis:

    • Determine high-resolution structures of both variants

    • Identify conformational differences, particularly in relation to the calcium-binding domains

    • Map the truncated regions onto the structure to understand their functional significance

  • Transport activity measurements:

    • Reconstitute both proteins into liposomes

    • Compare adenine nucleotide transport rates under various conditions

    • Determine substrate specificity profiles

    • Measure calcium dependency of transport activity

  • Calcium binding properties:

    • Quantify calcium binding affinities using isothermal titration calorimetry

    • Analyze conformational changes upon calcium binding using techniques like circular dichroism or fluorescence spectroscopy

    • Determine whether truncation affects calcium-induced conformational changes

  • Protein-protein interaction analysis:

    • Identify interaction partners for both variants

    • Determine if truncation affects interactions with mitochondrial membrane components or regulatory proteins

  • In vivo functional assays:

    • Test the ability of SAL1-1 to complement Δsal1Δaac2 synthetic lethality

    • Compare growth rates of strains expressing either variant

    • Measure mitochondrial adenine nucleotide content in vivo

The truncated SAL1-1 variant likely represents a valuable tool for understanding SAL1 function, as comparative analysis between functional and non-functional versions can highlight critical structural elements required for transport activity while potentially retaining calcium binding capability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.