Recombinant Saccharomyces cerevisiae Uncharacterized endoplasmic reticulum membrane protein YNL046W (YNL046W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. To request a specific tag, please indicate this in your order; we will prioritize your request.
Synonyms
YNL046W; N2530; Uncharacterized endoplasmic reticulum membrane protein YNL046W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL046W
Target Protein Sequence
MEHVSKRSIGQFFKRKTSTVDGSKSQKCGTTNQLRKLLHKRRVQKQAVPVESQYRIPGDF RDNQSVRVKNSMYNSSPSVTPSTHHINERYVRYDINTRPLVVVLAISIVFFGCLLVLKDI IIQSSENILSVSKWKIIGASFMGTPYTGLLTGLVGPLLSPFSAVSSWLSFIF
Uniprot No.

Target Background

Database Links

KEGG: sce:YNL046W

STRING: 4932.YNL046W

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is YNL046W and where is it localized in Saccharomyces cerevisiae?

YNL046W is an uncharacterized endoplasmic reticulum membrane protein found in Saccharomyces cerevisiae (baker's yeast). It is specifically localized to the endoplasmic reticulum (ER) membrane as indicated by its classification. The protein is encoded by the YNL046W gene in strain ATCC 204508/S288c of S. cerevisiae, and its UniProt accession number is P53956 . The protein is part of the vast proteome of S. cerevisiae, which serves as an excellent genetic model organism for studying fundamental cellular processes. While YNL046W's precise function remains uncharacterized, its membrane localization suggests potential roles in ER-associated processes such as protein folding, quality control, or membrane trafficking.

What expression systems are typically used for producing recombinant YNL046W protein?

Recombinant YNL046W protein is typically produced using established yeast expression systems optimized for membrane proteins. The most effective approach involves homologous expression in S. cerevisiae strains specifically engineered for protein overexpression. These systems often utilize strong inducible promoters such as GAL1 or constitutive promoters like PGK1 to drive high-level expression. Alternative heterologous expression systems include Pichia pastoris, which offers advantages for membrane protein expression due to its efficient secretory pathway. The choice of expression system depends on experimental requirements, including protein yield, post-translational modifications, and downstream applications. For structural studies, bacterial systems may be used for specific domains, though they often struggle with full-length membrane proteins due to differences in membrane composition and folding machinery.

How can researchers confirm successful expression of recombinant YNL046W?

Researchers can confirm successful expression of recombinant YNL046W through multiple complementary methods. Western blotting using antibodies against either the native protein or engineered epitope tags (commonly His, FLAG, or HA tags) provides verification of expression at the expected molecular weight . Immunofluorescence microscopy can confirm proper ER localization, while functional assays may detect changes in cellular phenotypes upon overexpression. For recombinant proteins intended for purification, small-scale expression trials followed by affinity purification can verify expression levels and solubility. Additionally, mass spectrometry analysis of purified protein fractions provides definitive identification of the YNL046W protein sequence. Initial expression trials should evaluate multiple growth conditions, including temperature, induction timing, and media composition to optimize yield and proper folding.

What experimental approaches are most effective for determining the function of YNL046W?

Determining the function of uncharacterized proteins like YNL046W requires a multi-faceted experimental approach. Gene deletion studies using CRISPR-Cas9 or traditional homologous recombination techniques in S. cerevisiae can reveal phenotypic consequences of YNL046W absence . Genome-wide genetic interaction screens through synthetic genetic array (SGA) analysis can identify functionally related genes, providing clues to biological pathways involving YNL046W. Proteomic approaches, including affinity purification coupled with mass spectrometry, can identify protein interaction partners. Transcriptomic analysis comparing wild-type and YNL046W deletion strains under various stress conditions may reveal affected pathways. Additionally, high-resolution localization studies using fluorescently-tagged YNL046W can pinpoint specific ER subdomains of localization. Complementary biochemical assays examining membrane topology, post-translational modifications, and potential enzymatic activities provide mechanistic insights. Integration of these multiple data streams offers the most comprehensive approach to functional characterization.

How can researchers differentiate between direct and indirect effects when studying YNL046W function?

Differentiating between direct and indirect effects in YNL046W functional studies requires rigorous experimental controls and complementary approaches. Time-course experiments capturing immediate versus delayed responses following YNL046W perturbation help distinguish primary from secondary effects. Performing rescue experiments with wild-type YNL046W in deletion strains confirms phenotype specificity. Structure-function analyses with point mutations in conserved domains can identify critical residues for specific activities. Using inducible or repressible expression systems allows temporal control to capture immediate functional consequences. Additionally, in vitro reconstitution experiments with purified components can directly test biochemical activities. Comparative studies across multiple yeast species can identify evolutionarily conserved functions versus species-specific adaptations. Integration of computational predictions with experimental validation strengthens functional assignments. Researchers should also consider the broader cellular context through systems biology approaches to map the network of interactions affected by YNL046W perturbation.

What are the challenges and solutions for structural characterization of YNL046W?

Structural characterization of YNL046W presents significant challenges due to its membrane localization. Membrane proteins typically express at lower levels, present difficulties in extraction from membranes, and have reduced stability in solution. To address these challenges, researchers can employ detergent screening to identify optimal conditions for protein solubilization while maintaining native conformation. Nanodiscs or amphipols provide alternative membrane-mimetic environments that better preserve protein structure. For crystallography attempts, researchers should consider protein engineering to remove flexible regions, introduce stabilizing mutations, or create fusion constructs with crystallization chaperones. Cryo-electron microscopy offers advantages for membrane proteins by eliminating crystallization requirements. Nuclear magnetic resonance spectroscopy can provide structural information for specific domains. Hydrogen-deuterium exchange mass spectrometry offers insights into protein dynamics and solvent accessibility. Additionally, computational approaches like homology modeling and molecular dynamics simulations can generate structural predictions to guide experimental design.

What purification strategies are optimal for isolating recombinant YNL046W?

Purifying recombinant YNL046W requires specialized approaches optimized for membrane proteins. The recommended protocol begins with careful cell lysis using either mechanical disruption (French press or sonication) or enzymatic methods with zymolyase for yeast cells. Membrane fractions are then isolated through differential centrifugation. Solubilization requires screening multiple detergents, with typical starting points including n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations above their critical micelle concentration. Affinity chromatography utilizing engineered tags (typically His6 or FLAG) provides initial purification, followed by size exclusion chromatography to separate protein-detergent complexes from aggregates and contaminants. Ion exchange chromatography offers additional purification if needed. Throughout purification, protein stability should be monitored by dynamic light scattering and thermal shift assays. Detergent concentration must be maintained above critical micelle concentration in all buffers, and glycerol (10-15%) often improves stability. For functional studies, reconstitution into proteoliposomes may be necessary to restore native activity.

How can researchers design genetic screens to identify interaction partners of YNL046W?

Genetic screens to identify YNL046W interaction partners can be designed using several complementary approaches. Synthetic genetic array (SGA) analysis systematically creates double mutants between a YNL046W deletion strain and the entire yeast deletion collection to identify genetic interactions . Synthetic lethality or enhanced/suppressed phenotypes indicate functional relationships. High-throughput suppressor screens, where cells with YNL046W deletion are transformed with genomic or cDNA libraries, can identify genes that rescue associated phenotypes. For protein-protein interactions, yeast two-hybrid screening using YNL046W domains as bait can identify direct binding partners, though membrane proteins may require modified split-ubiquitin systems. Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling, where YNL046W is fused to a biotin ligase, allows identification of proximal proteins in the native cellular environment. Tandem affinity purification coupled with mass spectrometry (TAP-MS) provides robust identification of stable protein complexes. For each approach, proper controls including wild-type strains, unrelated membrane proteins, and domain-specific constructs are essential to distinguish specific from non-specific interactions.

What analytical techniques are most informative for characterizing YNL046W post-translational modifications?

Characterizing post-translational modifications (PTMs) of YNL046W requires specialized analytical techniques with high sensitivity and specificity. Mass spectrometry-based approaches form the foundation of PTM analysis, with several complementary methods providing comprehensive coverage. Bottom-up proteomics involving protein digestion followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify modification sites with peptide-level resolution. Enrichment strategies specific to modification types improve detection sensitivity—phosphopeptides can be enriched using titanium dioxide or immobilized metal affinity chromatography, while glycopeptides can be captured using lectin affinity or hydrazide chemistry. Electron transfer dissociation (ETD) fragmentation preserves labile modifications better than collision-induced dissociation. Top-down proteomics analyzing intact proteins provides a holistic view of modification patterns and stoichiometry. Western blotting with modification-specific antibodies (phospho, ubiquitin, SUMO) offers targeted detection of specific modifications. For monitoring dynamic changes, pulse-chase labeling with stable isotopes combined with mass spectrometry provides temporal resolution of modification events. Site-directed mutagenesis of putative modification sites followed by functional assays confirms the biological significance of identified PTMs.

How does YNL046W contribute to understanding fundamental ER membrane processes?

YNL046W represents an important model for investigating fundamental endoplasmic reticulum membrane processes in eukaryotic cells. As an uncharacterized ER membrane protein, YNL046W research contributes to our understanding of protein targeting, membrane insertion, and ER quality control mechanisms. The protein likely participates in specialized ER functions such as lipid metabolism, calcium homeostasis, or secretory pathway regulation based on its localization. Comparative genomics indicates conservation of YNL046W-like proteins across fungi, suggesting evolutionarily preserved functions in ER biology. Studies of YNL046W and similar proteins have revealed novel mechanisms of membrane protein topology determination and retention signals that maintain ER localization. Additionally, investigation of uncharacterized ER proteins frequently uncovers previously unknown stress response pathways and specialized membrane domains. As approximately 30% of the yeast proteome remains functionally uncharacterized despite extensive study, research on proteins like YNL046W continues to fill critical gaps in our understanding of essential cellular processes. This research has broader implications for understanding human ER-associated diseases, as the basic machinery of ER function is conserved from yeast to humans.

What disease models or therapeutic applications might benefit from YNL046W research?

Research on YNL046W has potential implications for various disease models and therapeutic applications through comparative biology. While YNL046W itself is a yeast protein, investigations into its function and interactions can provide insights into conserved ER membrane processes relevant to human diseases. ER stress responses are implicated in neurodegenerative conditions like Alzheimer's, Parkinson's, and prion diseases, making YNL046W research valuable for understanding fundamental ER homeostasis mechanisms . If YNL046W is involved in protein quality control, findings may inform approaches to diseases caused by protein misfolding. The recombinant expression systems developed for YNL046W can serve as platforms for producing and studying human disease-associated membrane proteins that are otherwise difficult to express. Additionally, S. cerevisiae has proven valuable as a model organism for studying cancer-related pathways, with the GI-4000 series using recombinant yeast to stimulate immune responses against cancer cells expressing mutated Ras proteins . Understanding YNL046W membrane insertion and topology could inform drug delivery systems targeting the ER. As therapeutic approaches increasingly focus on targeting membrane proteins, methods optimized for YNL046W can accelerate development of similar strategies for human disease-associated membrane proteins.

How can computational approaches enhance experimental studies of YNL046W?

Computational approaches significantly enhance experimental studies of YNL046W by providing predictive frameworks, integrating diverse datasets, and generating testable hypotheses. Sequence-based analyses using hidden Markov models and neural networks predict secondary structure elements, transmembrane domains, and potential functional motifs to guide experimental design. Homology modeling can generate preliminary three-dimensional structural models based on related proteins, while ab initio modeling approaches like AlphaFold provide increasingly accurate structural predictions for novel proteins. Network analysis integrating proteomic, genetic interaction, and transcriptomic data can place YNL046W within broader functional contexts and predict biological roles. Molecular dynamics simulations offer insights into protein behavior within membrane environments, including conformational changes and potential ligand binding sites. Machine learning approaches applied to genomic and phenomic datasets can identify patterns suggesting function when direct experimental evidence is limited. Text mining algorithms scanning scientific literature can identify conceptually related proteins and processes not immediately apparent through conventional searches. These computational predictions should be viewed as complementary to experimental approaches, providing direction for targeted investigations rather than definitive functional assignments. The iterative cycle between computational prediction and experimental validation accelerates discovery for challenging targets like uncharacterized membrane proteins.

What are common pitfalls in recombinant YNL046W expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant YNL046W, each requiring specific troubleshooting approaches. Protein misfolding and aggregation often result from overexpression, which can be addressed by lowering induction temperature (20-25°C instead of 30°C), reducing inducer concentration, or using weaker promoters. Toxicity to host cells may occur if YNL046W disrupts membrane integrity or cellular processes; inducible expression systems with tight regulation minimize these effects. Low expression levels, common with membrane proteins, can be improved through codon optimization for the host organism and co-expression of chaperones like BiP or PDI to assist proper folding. Proteolytic degradation can be reduced by including protease inhibitors during extraction and adding stabilizing agents like glycerol to buffers. For improved solubilization, systematic detergent screening is essential, starting with mild detergents (DDM, LMNG) before testing harsher options (SDS, Triton X-100). If standard affinity tags affect folding or function, consider alternative tag positions or smaller tags. For proteins resistant to traditional approaches, cell-free expression systems provide an alternative that bypasses cellular toxicity issues. Each modification should be tested systematically, ideally with small-scale expression trials before scaling up.

What controls are essential in experiments involving YNL046W to ensure reliable results?

Robust experimental design for YNL046W studies requires multiple controls to ensure reliable, interpretable results. For genetic studies, both positive controls (known ER membrane proteins with characterized phenotypes) and negative controls (cytosolic or other non-ER proteins) establish baseline comparisons. When generating deletion strains, complementation with wild-type YNL046W confirms phenotypes result from the targeted deletion rather than secondary mutations . For protein interaction studies, testing for interactions with known non-specific binders identifies false positives, while confirmed interaction pairs serve as positive controls. When performing localization studies, co-staining with established ER markers confirms proper targeting. For biochemical assays, heat-denatured protein samples establish baseline activity levels. In overexpression studies, empty vector controls normalize for effects of the expression system itself. When introducing point mutations, conservative substitutions help distinguish functional from structural effects. For recombinant protein studies, purifying an established ER membrane protein using identical methods provides methodological validation. Time-course experiments should include appropriate early time points to capture direct effects. Statistical analysis should incorporate biological replicates (independent isolates) rather than just technical replicates. These comprehensive controls enable confident interpretation of experimental outcomes and distinguish specific YNL046W-related effects from experimental artifacts.

What statistical approaches are most appropriate for analyzing YNL046W phenotypic data?

Statistical analysis of YNL046W phenotypic data requires approaches tailored to the experimental design and data characteristics. For growth phenotype analysis, repeated measures ANOVA with post-hoc tests (Tukey's or Dunnett's) appropriately compares wild-type and mutant strains across multiple conditions while controlling for family-wise error rates. Non-parametric alternatives (Kruskal-Wallis with Dunn's post-hoc test) should be applied when normality assumptions are violated. For high-throughput screening data, false discovery rate controls (Benjamini-Hochberg procedure) are essential to manage multiple testing problems. Principal component analysis helps identify major sources of variation in complex phenotypic datasets, while hierarchical clustering groups similar phenotypic profiles. For genetic interaction studies, established scoring systems such as ε-scores or S-scores quantify interaction strength and directionality. Bayesian approaches can incorporate prior knowledge from related proteins to strengthen inferences from limited data. Power analysis should be performed during experimental design to determine appropriate sample sizes for detecting biologically meaningful effects. Reporting effect sizes alongside p-values provides insight into biological significance beyond statistical significance. Transparent reporting of all statistical methods, including assumptions testing, outlier handling, and software packages used, ensures reproducibility. For all analyses, consultation with statistical experts during experimental design rather than after data collection ensures optimal approaches.

How should researchers interpret contradictory findings about YNL046W function?

Contradictory findings regarding YNL046W function should be approached through systematic reconciliation strategies rather than dismissal. First, researchers should carefully examine methodological differences between studies, including yeast strain backgrounds, growth conditions, and assay parameters that may explain apparently conflicting results. Genetic background effects are particularly important as secondary mutations or polymorphisms can influence phenotypes . Differing expression levels across studies may lead to distinct outcomes, with physiological versus overexpression conditions potentially revealing different aspects of function. Post-translational modifications might vary across experimental conditions, altering protein function. Consider whether contradictions reflect distinct aspects of a multifunctional protein rather than true contradictions. Time-course studies may reveal that apparently contradictory effects occur at different temporal phases. Integration of contradictory findings into network models often reveals that the protein functions in multiple pathways with different outcomes. Direct replication attempts of conflicting studies, ideally through collaboration between labs reporting different results, can identify subtle methodological variables. Publication bias toward positive results means that confirmatory data may be underrepresented in literature. A robust approach involves triangulating function through multiple independent methods rather than relying on a single experimental paradigm. Finally, contradictions often highlight knowledge gaps that, when resolved, lead to more sophisticated understanding of protein function.

Table 1: YNL046W Research Applications and Methodological Approaches

Research AreaKey MethodologiesExpected OutcomesTechnical Considerations
Protein LocalizationFluorescent protein tagging, Immunogold EM, Subcellular fractionationPrecise ER subdomain mapping, Dynamics during stressTag interference with localization signals
Interaction PartnersAP-MS, Y2H, BioID, Genetic interaction screensProtein complex identification, Pathway associationsDetergent effects on interaction stability
Structural AnalysisCryo-EM, X-ray crystallography, HDX-MSMembrane topology, Domain organizationProtein stabilization during purification
Functional AnalysisCRISPR deletion, Conditional expression, Metabolic profilingPhenotypic consequences, Metabolic pathway involvementGenetic background effects on phenotypes
Post-translational ModificationsMass spectrometry, Site-directed mutagenesisRegulatory sites identification, Modification dynamicsEnrichment strategies for low-abundance modifications
Evolutionary ConservationComparative genomics, Complementation with orthologsConserved functional elements, Species-specific adaptationsSequence divergence vs. functional conservation

Table 2: Yeast Strains Used in YNL046W Research Studies

Strain DesignationGenotypeApplicationReference
AHJ1-3-19B [IC4Y12a]MATα ade2 ade3 leu2 ura3 his3Genetic screen for chromosome stabilitySleister et al., 1992
HS100-4A [IC4Y12a]MATa ade2 ade3 leu2 ura3 his3Mutant isolation in YAC stability studiesGenetics research course
BY4736MATα leu2Δ0 ura3Δ0 his3Δ200Control strain for heterozygous diploid analysesBaker's yeast genetic studies
YNL046W-GFPMATa his3Δ1 leu2Δ0 met15Δ0 ura3Δ0 YNL046W-GFP::HIS3Localization and dynamics studiesGFP collection
YNL046W-TAPMATa his3Δ1 leu2Δ0 met15Δ0 ura3Δ0 YNL046W-TAP::HIS3Protein complex purificationTAP collection
YNL046WΔMATa his3Δ1 leu2Δ0 met15Δ0 ura3Δ0 ynl046w::KanMX4Phenotypic analysisDeletion collection

What emerging technologies will advance understanding of YNL046W function?

Emerging technologies across multiple disciplines hold promise for advancing our understanding of YNL046W function. Cryo-electron tomography enables visualization of proteins in their native cellular environment without extraction, potentially revealing YNL046W's precise organization within the ER membrane. Single-molecule tracking using photoactivatable fluorescent proteins can capture dynamic behaviors and transient interactions that traditional approaches miss. Microfluidics-based approaches permit precise control of environmental conditions while monitoring cellular responses in real-time. CRISPR-based screens with single-cell readouts offer unprecedented resolution for identifying genetic interactions. Proximity labeling methods with engineered peroxidases like APEX2 capture weak or transient protein interactions in native environments. For structural studies, micro-electron diffraction (microED) requires smaller crystals than traditional X-ray crystallography, potentially overcoming challenges in membrane protein crystallization. Mass photometry provides label-free characterization of protein complexes at near-single-molecule resolution. In genomics, long-read sequencing technologies better capture structural variations affecting YNL046W regulation. Developments in computational approaches, including structure prediction algorithms like AlphaFold2, are increasingly accurate for membrane proteins. Integrative structural biology combining multiple data types (cross-linking, HDX-MS, cryo-EM) into unified models offers holistic structural understanding. As these technologies mature, their application to YNL046W will likely reveal functional insights not accessible through conventional approaches.

How might systems biology approaches enhance understanding of YNL046W in cellular context?

Systems biology approaches offer powerful frameworks for understanding YNL046W within its broader cellular context by integrating multiple data types and modeling complex relationships. Multi-omics integration combining transcriptomics, proteomics, metabolomics, and lipidomics data from YNL046W mutants can reveal system-wide effects beyond direct interactions. Network modeling approaches incorporating protein-protein, genetic, and metabolic interactions place YNL046W within the cellular interactome and identify emergent properties not apparent from isolated studies . Flux balance analysis can predict metabolic consequences of YNL046W perturbation. Dynamic modeling incorporating time-resolved data captures temporal aspects of YNL046W function during various cellular processes and stress responses. Constraint-based modeling frameworks integrate biochemical, thermodynamic, and regulatory constraints to predict system behavior under various conditions. Comparative systems approaches across multiple yeast species can identify conserved network motifs involving YNL046W orthologs. Single-cell analyses reveal cell-to-cell variability in YNL046W expression and function, potentially identifying subpopulations with distinct behaviors. Perturbation-based approaches systematically testing YNL046W function across diverse environmental conditions create comprehensive phenotypic profiles. These systems-level approaches shift focus from individual components to emergent properties, capturing the complex reality of cellular function where proteins like YNL046W operate within highly interconnected networks rather than in isolation.

How can researchers contribute to community knowledge about YNL046W?

Researchers can significantly advance community knowledge about YNL046W through strategic contribution approaches that maximize impact and accessibility. Standardizing experimental methods for YNL046W studies and thoroughly documenting protocols in repositories like Protocols.io enables reproducibility and method refinement. Contributing structural data to the Protein Data Bank, even partial structures or domains, builds cumulative knowledge. Submitting comprehensive phenotypic datasets to databases like the Saccharomyces Genome Database ensures findings reach the broader community even when they don't fit narrative publications . Developing and sharing specialized reagents such as antibodies, tagged strains, or purification protocols through repositories like Addgene accelerates research across laboratories. Participating in community annotation efforts to update database entries with newly discovered functions or interactions improves information accessibility. Publishing negative results prevents duplication of unsuccessful approaches and provides valuable constraints on function. Engaging in collaborative consortium projects addressing uncharacterized yeast proteins leverages complementary expertise across institutions. Creating computational models and algorithms that integrate YNL046W data and sharing through open repositories enables broader utilization. Forming interdisciplinary collaborations connecting YNL046W research to related fields expands impact. Mentoring students using YNL046W as a research training model, similar to undergraduate research courses, simultaneously advances knowledge while developing scientific workforce . Through these coordinated contribution approaches, the collective understanding of YNL046W advances more rapidly than through traditional isolated research efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.