Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YAL064W-B (YAL064W-B)

Shipped with Ice Packs
In Stock

Description

General Information

YAL064W-B is an uncharacterized membrane protein found in Saccharomyces cerevisiae (budding yeast) . It is a fungal-specific protein with an unknown function, comprising 126 amino acids . YAL064W-B exhibits some similarity to sialidase from Trypanosoma . The gene encoding YAL064W-B is not essential for yeast survival .

Genomic Context and Expression

YAL064W-B is located near the YAL065C gene on the yeast genome . Studies on intergenic distances in S. cerevisiae have noted the close spacing between these genes .

Predicted Functional Partners

STRING analysis predicts several proteins as functional partners of YAL064W-B :

  • TDA8: Topoisomerase I damage affected protein 8. It is a putative protein of unknown function .

  • YHR213W: Putative uncharacterized protein with similarity to flocculins .

  • YHR213W-A: Uncharacterized protein of unknown function .

  • MAK32: Protein necessary for the stability of L-A dsRNA-containing particles .

  • YMR317W: Uncharacterized protein with some similarity to sialidase from Trypanosoma .

  • SNO2: Probable pyridoxal 5'-phosphate synthase subunit SNO2, a protein of unknown function .

  • PRM7: Pheromone-regulated protein predicted to have one transmembrane segment .

  • ISF1: Increasing suppression factor 1, a serine-rich, hydrophilic protein .

  • FRK1: Fatty acyl-CoA synthetase and RNA processing-associated kinase 1, a protein kinase of unknown cellular role .

  • DAN4: Cell wall mannoprotein expressed under anaerobic conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. To ensure a specific tag type, please specify your requirements; we will prioritize fulfilling custom tag requests.
Synonyms
YAL064W-B; Uncharacterized membrane protein YAL064W-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YAL064W-B
Target Protein Sequence
MAGEAVSEHTPDSQEVTVTSVVCCLDSVVEIGHHVVYSVVTPLIVAVLIDTMAGEAVLEH TSDSQEEIVTTVVCSVVPLVCFVVSVVCFVISVVEIGHHVVYSVVAPLTVTVAVETIAEE MDSVHT
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YAL064W-B and what is currently known about its function?

YAL064W-B is an uncharacterized membrane protein in Saccharomyces cerevisiae that is classified as a fungal-specific protein of unknown function. Current genomic databases identify it as a protein-coding gene, but its specific biological role remains largely undetermined. The protein has been detected across multiple S. cerevisiae strains with sequence identity varying between 91-93% compared to the reference strain .

The lack of comprehensive functional characterization makes this protein an intriguing candidate for research focusing on novel fungal-specific cellular processes. Experimental evidence suggests it localizes to membrane structures, which may indicate potential roles in transport, signaling, or membrane organization.

What protein interactions have been identified for YAL064W-B?

YAL064W-B has been found to interact with multiple proteins in the yeast interactome. The top interactors (based on interaction scores) include:

InteractorInteraction Score
YHR213W0.782
YHR213W-A0.779
YMR317W0.750
ISF10.745
PRM70.712
FRK10.708
PAU30.700
ENA50.650
TIR20.616
YLR154W-F0.615

These interactions suggest potential involvement in cellular processes mediated by these interacting partners. The highest scoring interaction with YHR213W (score 0.782) indicates a particularly strong functional relationship that may be of interest for further investigation .

How conserved is YAL064W-B across different yeast strains?

YAL064W-B shows notable conservation across different S. cerevisiae strains, though with some sequence variations. Analysis of various industrial and wild strains reveals:

StrainAssemblyApplicationRegion% Identity% CoverageStatus
AKU4011GCA_001738255.1SakeAsia92.7100.0Verified
BG1GCA_001932575.1BioethanolSouth America92.5100.0Verified
BruggemanGCA_001738585.1BreadNot Applicable92.5100.0Verified
CAT1GCA_001738705.1BioethanolSouth America92.0100.0Verified
CBS1585GCA_001738375.1SakeAsia91.7100.0Verified

This conservation pattern suggests the protein likely serves a consistent biological function across diverse yeast strains despite minor sequence variations. The 100% coverage across all strains indicates no major structural changes or domain losses .

What are the optimal methods for studying YAL064W-B expression levels in different environmental conditions?

For studying YAL064W-B expression levels under varying environmental conditions, a combination of microarray analysis and quantitative PCR is recommended. Based on research methodologies, a hierarchical Bayesian approach can be particularly effective for analyzing gene expression data.

When designing expression experiments, consider:

  • Temperature effects: Evidence suggests temperature significantly affects hybridization signal intensities, with the effect varying by strain. For YAL064W-B, temperature-dependent expression has been observed, necessitating careful temperature control during experiments .

  • Strain selection: Use both laboratory reference strains and industrial strains for comparative analysis, as expression patterns may differ substantially.

  • Statistical analysis: Implement Bayesian analysis frameworks that can account for strain-gene specific temperature effects using a mixture prior approach. This allows for more accurate detection of differential expression:

p(θijkpM)=log2(μi+μg+μjt+μk+μp+βjt+μd+p)p(\theta_{ijkp}^M) = \log_2(\mu_i + \mu_g + \mu_j^t + \mu_k + \mu_p + \beta_j^t + \mu_d + p)

Where parameters represent various experimental factors including strain-specific temperature effects (β_j^t) .

For microarray studies specifically, ensure hybridization temperatures are standardized (typically at both 50°C and 60°C) to account for temperature-dependent binding effects that may obscure true expression differences.

What approaches can be used to investigate YAL064W-B's membrane localization and topology?

To investigate YAL064W-B's membrane localization and topology, a multi-faceted approach combining biochemical, genetic, and imaging techniques is recommended:

  • Fluorescent protein tagging: Generate YAL064W-B fusion constructs with GFP or other fluorescent markers. Place tags at different positions (N-terminal, C-terminal, or internal loops) to minimize disruption of targeting signals while enabling visualization of subcellular localization through confocal microscopy.

  • Membrane fractionation: Perform differential centrifugation followed by sucrose gradient fractionation to isolate different membrane compartments. Western blotting with anti-YAL064W-B antibodies or detection of epitope-tagged versions can identify which membrane fractions contain the protein.

  • Protease protection assays: To determine topology (orientation in the membrane), treat isolated membrane fractions with proteases (with or without membrane permeabilization) and analyze the resulting fragments to identify which portions are protected from digestion.

  • Split-GFP complementation: Use this method to determine the orientation of specific domains by expressing fragments of GFP fused to different portions of YAL064W-B and to markers of known localization.

  • Cryo-electron microscopy: For structural studies, purify the protein in detergent micelles or nanodiscs and use cryo-EM for high-resolution structural analysis.

These approaches should be conducted with proper controls, including known membrane proteins with established topologies and localization patterns.

How can researchers effectively generate and validate YAL064W-B deletion mutants?

To generate and validate YAL064W-B deletion mutants effectively, follow this methodological approach:

  • Deletion strategy design:

    • Design PCR primers with 40-50bp homology arms flanking the YAL064W-B open reading frame

    • Include a selectable marker (e.g., KanMX4 for G418 resistance) for positive selection

    • Consider retaining the start and stop codons to minimize effects on neighboring genes

  • Transformation procedure:

    • Use high-efficiency lithium acetate/PEG transformation of S. cerevisiae

    • For highest efficiency, ensure cells are in mid-log phase (OD600 0.6-0.8)

    • Heat shock at 42°C for exactly 40 minutes for optimal DNA uptake

    • Include a recovery period in YPD before selection

  • Validation methods (employ at least three):

    • PCR verification: Use primers outside the targeted region to confirm correct integration

    • Southern blot analysis: To verify single integration and absence of additional insertions

    • RT-PCR: To confirm absence of YAL064W-B transcript

    • Western blot: If antibodies are available, confirm absence of protein expression

    • Genome sequencing: For definitive confirmation of the deletion and to check for unintended mutations

  • Phenotype assessment:

    • Compare growth rates in multiple media conditions (YPD, minimal media, stress conditions)

    • Analyze membrane integrity using dyes like propidium iodide

    • Examine interactions with known partners using co-immunoprecipitation or yeast two-hybrid assays

    • Perform comparative transcriptomics to identify compensatory changes in gene expression

For complementation studies, reintroduce YAL064W-B under its native promoter using a different selectable marker to confirm phenotypes are specifically due to the absence of YAL064W-B.

How should researchers interpret YAL064W-B expression data across different yeast strains?

When interpreting YAL064W-B expression data across different yeast strains, researchers should implement a systematic analytical framework that accounts for strain-specific variations:

  • Normalized expression comparison: Always normalize expression data using stable reference genes appropriate for the conditions being tested. For comparing industrial strains with laboratory strains, the Bayesian hierarchical model approach has shown significant advantages by allowing differential shrinkage of estimates based on the reliability of measurements .

  • Temperature effect correction: The expression data for YAL064W-B shows strain-specific temperature sensitivity during hybridization experiments. Based on the posterior densities of temperature effects (βⱼᵗ), researchers should implement temperature correction factors when comparing data collected at different temperatures .

  • Strain-specific baseline establishment: Expression levels should be interpreted relative to strain-specific baselines rather than absolute values. For example, the posterior distribution analysis shows that the strain effect can significantly affect measured expression levels, as demonstrated in this relationship:

θijkpM=log2(μi+μg+μjt+μk+μp+βjt+μd+p)\theta_{ijkp}^M = \log_2(\mu_i + \mu_g + \mu_j^t + \mu_k + \mu_p + \beta_j^t + \mu_d + p)

  • Statistical significance assessment: When identifying differential expression, consider both statistical significance and biological significance. The empirical distribution of log2ratios for deleted/diverged genes shows an average fold change of about -3.7, which can serve as a reference point for significant changes .

  • Contradictory data resolution: When encountering contradictory results between single-array analysis and Bayesian analysis (as seen with YAL064W-B, which showed significance in 6 arrays using Newton's method but was not significant in the Bayesian analysis), prioritize the Bayesian approach which provides stronger shrinkage of estimates and reduces false positives .

What bioinformatics pipelines are most effective for analyzing YAL064W-B structure and potential function?

For analyzing YAL064W-B structure and predicting its potential function, a comprehensive bioinformatics pipeline should integrate multiple computational approaches:

  • Sequence analysis and homology detection:

    • PSI-BLAST and HHpred for sensitive detection of remote homologs

    • HMMER searches against specialized membrane protein databases

    • Analysis of conservation patterns across fungal species to identify functional motifs

  • Structural prediction and analysis:

    • AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • TMHMM, TOPCONS, and Phobius for transmembrane topology prediction

    • Molecular dynamics simulations to assess stability in membrane environments

    • Protein-protein docking with known interactors (e.g., YHR213W with 0.782 interaction score)

  • Functional annotation:

    • Gene Ontology enrichment analysis of interacting partners

    • Pathway analysis tools (KEGG, Reactome) to identify potential involvement in known pathways

    • Protein domain analysis using InterProScan and Pfam

    • Comparative analysis with characterized membrane proteins in other fungi

  • Expression correlation networks:

    • Co-expression analysis with known genes across multiple conditions

    • Network-based function prediction using STRING and BioGRID interaction data

    • Bayesian network approaches to infer regulatory relationships

  • Visualization and interpretation:

    • Integrate results using platforms like Cytoscape for network visualization

    • Use PyMOL or UCSF Chimera for structural visualization and analysis

    • Implement interactive dashboards (R Shiny) for data exploration across strains

This pipeline should be iterative, with results from one approach informing refinements in others. For example, structural predictions might identify potential binding sites that can be validated through targeted mutation experiments.

How can contradictory experimental results regarding YAL064W-B function be reconciled?

When faced with contradictory experimental results regarding YAL064W-B function, researchers should employ the following systematic approach to reconcile discrepancies:

  • Methodological variation analysis:

    • Examine differences in experimental conditions (temperature, media, strain background)

    • Compare analytical methods - single-array analysis identified YAL064W-B in 6 spots while Bayesian analysis did not identify it as significantly different, suggesting method-dependent outcomes

    • Assess technical variables such as hybridization temperatures, which show strain-specific effects on signal intensity

  • Strain-specific effects evaluation:

    • Consider that YAL064W-B may function differently across strains

    • Analysis of sequence variations (91.7-92.7% identity across strains) may explain functional differences

    • Determine if contradictory results correlate with specific strain backgrounds

  • Statistical reconciliation approach:

    • Implement meta-analysis techniques to integrate results from multiple studies

    • Apply Bayesian hierarchical models that can account for study-specific biases:
      p(θijkpM)=log2(μi+μg+μjt+μk+μp+βjt+μd+p)p(\theta_{ijkp}^M) = \log_2(\mu_i + \mu_g + \mu_j^t + \mu_k + \mu_p + \beta_j^t + \mu_d + p)

    • Use shrinkage estimators to reduce the influence of outlier results

  • Experimental reconciliation strategy:

    • Design critical experiments specifically addressing contradictions

    • Perform parallel experiments in multiple strains under identical conditions

    • Use orthogonal methods to test the same hypothesis (e.g., complement proteomics with transcriptomics)

    • Consider protein-protein interaction contexts, as YAL064W-B interacts with multiple partners that may modulate its function

  • Ecological context consideration:

    • Evaluate if contradictions reflect genuine biological plasticity

    • Consider that S. cerevisiae strains adapt to different environments, which may explain functional variations

    • Analyze YAL064W-B in the context of non-Saccharomyces interactions, as S. cerevisiae is known to suppress certain species while favoring others

By systematically addressing these aspects, researchers can develop a more nuanced understanding of YAL064W-B function that accommodates seemingly contradictory results.

How might YAL064W-B's function relate to S. cerevisiae's ecological interactions with other yeast species?

YAL064W-B, as an uncharacterized membrane protein, may play a significant role in S. cerevisiae's ecological interactions with other yeast species through several potential mechanisms:

  • Intercellular signaling: As a membrane protein, YAL064W-B could function in recognizing signals from other yeast species or in producing signals that affect their growth. Research on S. cerevisiae interactions with non-Saccharomyces yeasts shows that S. cerevisiae specifically suppresses certain species while appearing to favor the persistence of others during fermentation processes . YAL064W-B might be involved in this selective suppression mechanism.

  • Competition for resources: S. cerevisiae has been observed to create unconducive environments for species like W. anomalus, leading to their early decline in fermentation . YAL064W-B could participate in nutrient sequestration or modification of the extracellular environment to provide competitive advantages.

  • Stress response mediation: The differential survival of yeast species in mixed cultures might be linked to species-specific stress responses. For example, when S. cerevisiae reaches concentrations of 6.47 × 10⁴ CFU/mL, a decline in W. anomalus, P. terricola, and M. pulcherrima populations occurs, while L. thermotolerans and S. bacillaris remain viable . YAL064W-B could be involved in producing or responding to stress factors that affect species differently.

To investigate these potential roles, researchers should design experiments comparing wild-type and YAL064W-B deletion mutants in mixed-culture fermentations with non-Saccharomyces yeasts. Analysis should include:

  • Quantitative assessment of population dynamics using methods like ARISA (Automated Ribosomal Intergenic Spacer Analysis) and selective plating

  • Metabolomic profiling to identify differences in extracellular metabolites

  • Transcriptomic analysis of both S. cerevisiae and non-Saccharomyces species in mixed cultures

  • Protein localization studies during interspecies interactions

These approaches would help establish whether YAL064W-B contributes to S. cerevisiae's ecological dominance in mixed yeast communities.

What role might YAL064W-B play in stress response and adaptation in industrial fermentation strains?

YAL064W-B may serve critical functions in stress response and adaptation in industrial fermentation strains, particularly given its conservation across diverse industrial isolates:

  • Strain-specific expression patterns: YAL064W-B is present in multiple industrial strains (Sake, Bioethanol, Bread) with sequence identity ranging from 91.7% to 92.7% compared to the reference genome . This conservation across strains adapted to different industrial processes suggests functional importance in diverse stress conditions.

  • Membrane integrity during stress: As a membrane protein, YAL064W-B could maintain membrane homeostasis under fermentation-associated stresses (ethanol, osmotic pressure, temperature fluctuations). This hypothesis is supported by the strain-specific temperature effects observed in gene expression studies .

  • Interaction with stress-response pathways: YAL064W-B interacts with several proteins including ISF1 (interaction score 0.745) , which is involved in mitochondrial function and potentially in stress response. This suggests a possible role in coordinating cellular responses to environmental challenges.

For rigorous investigation of these potential roles, researchers should implement:

  • Comparative stress tolerance assays between wild-type and YAL064W-B deletion mutants under various industrial stresses:

Stress ConditionParameters to TestMeasurements
Ethanol5-18% (v/v)Growth rate, viability, membrane integrity
Temperature10-40°CHeat shock protein induction, growth recovery
Osmotic20-40% glucose/sorbitolHOG pathway activation, glycerol production
Oxidative0.5-5mM H₂O₂ROS accumulation, antioxidant enzyme activity
pHpH 2.5-8.0Proton pumping, intracellular pH maintenance
  • Transcriptomic and proteomic profiling of industrial strains under stress conditions, comparing wild-type and YAL064W-B mutants

  • Lipidomic analysis to determine if YAL064W-B affects membrane composition during stress

  • In situ localization studies to determine if YAL064W-B relocates within the membrane during stress exposure

This comprehensive approach would establish whether YAL064W-B functions as a stress-responsive element in industrial yeast strains and potentially explain its conservation despite being "uncharacterized."

What advanced genetic engineering approaches could be employed to elucidate YAL064W-B's function through domain-specific modifications?

To elucidate YAL064W-B's function through domain-specific modifications, several cutting-edge genetic engineering approaches can be implemented:

  • CRISPR-Cas9 based domain editing:

    • Design precise modifications targeting predicted functional domains without disrupting the entire protein

    • Implement base editing for single amino acid substitutions at conserved residues

    • Apply prime editing for small insertions/deletions within specific domains

    • Create a systematic library of domain variants using multiplexed CRISPR screens

  • Domain-specific tagging with minimal functional disruption:

    • Employ split-GFP complementation system with nanobody/epitope insertions at predicted loop regions

    • Utilize SpyTag/SpyCatcher or HaloTag systems for in situ labeling of specific domains

    • Implement conditional degradation domains (e.g., auxin-inducible degrons) within specific regions to assess domain-specific contributions to function

  • Chimeric protein engineering:

    • Create domain swaps with homologous proteins from related yeast species

    • Design synthetic chimeras replacing specific domains with functionally characterized domains from other membrane proteins

    • Generate minimal functional constructs to identify essential domains

  • High-resolution mutagenesis approaches:

    • Apply deep mutational scanning combined with selection for specific phenotypes

    • Implement TAPIR (targeted protein interaction reporter) to assess how mutations affect specific protein-protein interactions

    • Use saturation mutagenesis of predicted transmembrane regions to identify critical residues

  • Conditional expression and regulation systems:

    • Design domain-specific inducible expression systems to control individual functional elements

    • Implement optogenetic control of domain conformation or activity

    • Create tension-sensitive domains to assess mechanical functions in the membrane

Methodological example for implementation:

For identifying functional domains involved in protein-protein interactions with key partners like YHR213W (interaction score 0.782) , researchers could:

  • Generate a library of domain-specific variants using CRISPR-Cas9

  • Implement a split-reporter system (e.g., split-luciferase) fused to YHR213W

  • Screen for variants with altered interaction profiles

  • Validate candidates using orthogonal methods such as co-immunoprecipitation

  • Correlate structural predictions with functional outcomes using molecular dynamics simulations

How could integrative multi-omics approaches advance our understanding of YAL064W-B's role in cellular processes?

Integrative multi-omics approaches offer powerful strategies to comprehensively elucidate YAL064W-B's role in cellular processes by connecting different layers of biological information:

  • Synchronized multi-omics experimental design:

    • Parallel sampling for transcriptomics, proteomics, metabolomics, and lipidomics from wild-type and YAL064W-B deletion strains under identical conditions

    • Time-course experiments capturing dynamic changes during environmental transitions

    • Cross-strain comparisons including industrial strains with different YAL064W-B variants (91.7-92.7% identity)

  • Advanced analytical integration methods:

    • Implement Bayesian data integration frameworks that can handle the heterogeneity of multi-omics data

    • Apply network-based integration approaches to identify functional modules affected by YAL064W-B

    • Utilize transfer learning algorithms to leverage information across different omics layers

    • Implement the hierarchical model framework that has successfully identified strain-specific effects in previous studies :
      p(θijkpM)=log2(μi+μg+μjt+μk+μp+βjt+μd+p)p(\theta_{ijkp}^M) = \log_2(\mu_i + \mu_g + \mu_j^t + \mu_k + \mu_p + \beta_j^t + \mu_d + p)

  • Specific multi-omics approaches for membrane protein function:

    Omics LayerTechniqueSpecific Application to YAL064W-B
    GenomicsLong-read sequencingStructural variants affecting YAL064W-B across strains
    TranscriptomicsRNA-seq, ribosome profilingExpression correlation networks with YAL064W-B
    ProteomicsQuantitative membrane proteomicsYAL064W-B abundance and PTMs across conditions
    InteractomicsBioID, APEX proximity labelingIn situ identification of proximal proteins
    LipidomicsLC-MS/MS lipid profilingMembrane composition changes in deletion mutants
    MetabolomicsUntargeted metabolomicsMetabolic consequences of YAL064W-B deletion
    PhenomicsHigh-content screeningPhenotypic signatures of YAL064W-B variants
  • Computational integration strategies:

    • Implement multi-view machine learning approaches

    • Apply causal network inference to establish directionality between observations

    • Develop YAL064W-B-specific integrated visualization tools for data exploration

  • Validation through targeted approaches:

    • Design targeted experiments to test hypotheses generated from multi-omics integration

    • Create reporter systems for key pathways identified through integration

    • Implement CRISPR-mediated perturbations of candidate interacting partners

By implementing this integrative approach, researchers can overcome the limitations of single-omics studies and establish a comprehensive understanding of YAL064W-B's functional context within the cell's molecular networks.

What are the implications of YAL064W-B conservation for understanding fundamental aspects of fungal membrane biology?

The conservation of YAL064W-B across diverse Saccharomyces cerevisiae strains (91.7-92.7% sequence identity) has significant implications for understanding fundamental aspects of fungal membrane biology:

  • Evolutionary conservation and specialization:

    • YAL064W-B is described as a "fungal-specific protein of unknown function" , suggesting it evolved to serve specialized functions in fungi

    • Its consistent presence across industrial strains (Sake, Bioethanol, Bread) from different geographical regions indicates selection pressure to maintain this gene

    • Comparative genomics across the broader fungal kingdom could reveal whether YAL064W-B represents a core component of fungal membrane biology or a Saccharomycetes-specific adaptation

  • Membrane organization principles:

    • As an uncharacterized membrane protein, YAL064W-B may participate in fungal-specific membrane organizational features

    • Its interactions with multiple partners (YHR213W, YHR213W-A, YMR317W) suggest involvement in protein complexes that may form functional membrane microdomains

    • Understanding YAL064W-B could reveal principles of membrane compartmentalization unique to fungi

  • Comparative membrane biology implications:

    • The fungal-specific nature of YAL064W-B highlights the divergence of eukaryotic membrane biology across kingdoms

    • Studying YAL064W-B function may reveal membrane adaptations that contributed to fungal evolutionary success

    • Its absence in mammals makes it potentially relevant for understanding fundamental differences in membrane organization between fungi and higher eukaryotes

  • Research approaches to explore these implications:

    ApproachMethodologyExpected Insight
    Evolutionary analysisPhylogenetic profiling across fungiEmergence and diversification patterns
    Structural comparisonsCryo-EM of YAL064W-B in membrane contextFungal-specific membrane protein folding principles
    Lipid interaction studiesLipidomics combined with protein-lipid binding assaysFungal-specific lipid-protein interactions
    Comparative deletion phenotypingGrowth/stress phenotyping across speciesConservation of functional importance
    Heterologous expressionExpression in mammalian cellsCompatibility with non-fungal membranes
  • Theoretical framework development:

    • Integrate findings about YAL064W-B into broader conceptual models of fungal membrane biology

    • Develop testable hypotheses about the emergence of specialized membrane structures in fungi

    • Create computational models of membrane organization incorporating YAL064W-B's structural features

By investigating these aspects, researchers can use YAL064W-B as a lens through which to understand fundamental principles of fungal membrane biology and evolution, potentially revealing new targets for antifungal development and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.