Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YCR023C (YCR023C)

Shipped with Ice Packs
In Stock

Description

Ion Transport Activity

When expressed in HeLa cells, YCR023C increased whole-cell chloride currents, displaying outward rectification and sensitivity to inhibitors like DIDS, NFA, and NPPB . These properties align with chloride channel activity observed in CLN7 homologs, though direct functional confirmation remains pending .

Multidrug Resistance Associations

YCR023C is annotated as a multidrug permease homolog in S. cerevisiae genomic databases, grouping it with proteins like YML116w (ATR1/SNQ1) and YPR198w (SGE1/NOR1) . While not experimentally validated, this classification hints at a potential role in detoxification or drug efflux.

Recombinant Expression in S. cerevisiae

Recombinant production leverages S. cerevisiae’s advantages in eukaryotic post-translational modifications and cost-effective scaling . Key methods include:

StepDetailsSource
Vector Selection83Xi plasmid (GAP-compatible) with N-terminal His-tag and thrombin cleavage site .
InductionGalactose (20X) or raffinose (10X) solutions for controlled expression .
Competent Cell PreparationStrain W303-Δpep4 (MATα) grown in YPD broth, frozen in 15% glycerol .

Functional Assays

  • Electrophysiology: Chloride current measurements in HeLa cells revealed outward-rectifying currents (I-V curves) .

  • Localization Studies: Fluorescence microscopy confirmed PM and intracellular distribution in heterologous systems .

Comparative Analysis with Human CLN7

While YCR023C shares structural homology with CLN7, key differences are evident:

FeatureYCR023CHuman CLN7
LocalizationVacuolar membrane (native) / PM (heterologous)Lysosomal membrane
Ion ConductanceChloride currents (inferred)Chloride channel confirmed
Disease AssociationNone reportedBatten disease (neuronal ceroid lipofuscinosis)

Potential Roles

  1. Chloride Transport: May regulate organelle pH or ion balance in vacuoles .

  2. Drug Resistance: Hypothetical role in multidrug efflux, though functional validation is required .

  3. Model System Utility: Recombinant YCR023C could serve as a tool to study membrane protein folding or trafficking in S. cerevisiae .

Knowledge Gaps

  • Direct Functional Proof: No biochemical assays (e.g., transport assays) have confirmed substrate specificity.

  • Regulatory Mechanisms: Ligands, interacting partners, or post-translational modifications remain unexplored.

Table 1: YCR023C in S. cerevisiae Multidrug Permease Homologs

GeneSynonymGenBank AccessionDescription
YCR023CUncharacterized multidrug permease homolog
YML116wATR1/SNQ1Z49210Aminotriazole resistance protein
YPR198wSGE1/NOR1U25841Crystal violet resistance protein

Table 2: YCR023C Expression and Localization

SystemLocalizationMethod
Native S. cerevisiaeVacuolar membraneGenomic annotation
Heterologous (HeLa)Plasma membrane, intracellular organellesFluorescence microscopy

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YCR023C; YCR23C; YCR241; Uncharacterized membrane protein YCR023C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-611
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YCR023C
Target Protein Sequence
MARQKLTFKEQMDGFPWVQLVVVSLVRFSEPIAFSSLFPYVYFMVRDFNIAPNDAQVSKY SGYLSSSFALCQVISAYHWGRFSEKHGRKITLTCGLIGTSVSLLILGFSRNFYQALVARS LMGLLNGNVGVIRTIIGEIATERKHQALAFSTMPLLFQFGAVVGPMIGGFLVFRDGTMNE VPLWFPHFAKRIIRSYPYALPNVVVCMFLMFGLTNATLFLEETHPAFKDRRDYGLEVGDF IKKNIFGIQPKRRPWQKRIQDDSENIHHRNENVNSIRGQDSEEDENSPLVNTTNDDDTES IQSIDPILTRRQSVGLIRTYSLHEPTDAVHANIDTAPDGCKESSIFHHVFHTKVFYPISV NFIMALHLIVYNEFLPVFLAYDLAVDPENPKKLASKFPWKISGGIGYEPEQTGTLLSTTG IFGCFVVIFIFPIVDRNFDCLTIFRTLVKLYPIMYVMVPYVVFLQNERIPSWYTVVYLYI ITGIKTFCGALTSPQIMLLIHNSSPLSCRSVINGATISISASARFIGPLVWGYIMSWSQQ NDVAWVSWWSLSLFCMVALYQSYKIAPIDDNENELHGQGSEDAYNSQSQSSDLRMAHRSS LSSLSNQRCTT
Uniprot No.

Target Background

Database Links

KEGG: sce:YCR023C

STRING: 4932.YCR023C

Protein Families
Major facilitator superfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YCR023C and how is it classified?

YCR023C is classified as a Major Facilitator Superfamily (MFS) domain-containing protein in Saccharomyces cerevisiae. It is a translation product of the YCR023C gene in yeast and is currently designated as an uncharacterized membrane protein . The protein is indexed in UniProt under accession number P25351 with the ID YCR3_YEAST, and is derived from the reference strain ATCC 204508/S288c . As an MFS protein, YCR023C likely functions as a transporter that facilitates the movement of small solutes across cellular membranes in response to chemiosmotic gradients, though its specific substrates and regulatory mechanisms remain to be fully elucidated.

What approaches can be used to predict potential functions of YCR023C?

Multiple complementary approaches can be employed to predict the function of an uncharacterized membrane protein like YCR023C:

  • Homology-based prediction: Compare the protein sequence with characterized proteins using tools like BLAST, HHpred, or Pfam to identify functional domains and potential homologs.

  • Phylogenetic profiling: Analyze the evolutionary conservation and co-occurrence patterns of YCR023C across different fungal species to infer potential functional relationships.

  • Gene neighborhood analysis: Examine genomic context for co-located genes that may participate in similar pathways.

  • Expression correlation networks: Identify genes with similar expression patterns to YCR023C across multiple conditions, suggesting potential functional relationships.

  • Protein-protein interaction predictions: Use tools like STRING or BioGRID to predict interaction partners.

A systematic prediction approach combining these methods has proven effective for annotating uncharacterized proteins in model organisms like S. cerevisiae . When studying YCR023C, it is essential to validate computational predictions with experimental evidence, particularly given the structural complexity of membrane proteins.

How can researchers generate recombinant strains expressing YCR023C for functional studies?

The generation of recombinant S. cerevisiae strains expressing modified YCR023C requires careful consideration of several factors:

Recommended Protocol:

  • Vector selection: For membrane proteins, vectors with moderate promoters (e.g., TEF1) often provide better expression than strong promoters (e.g., GPD), which can lead to protein aggregation and toxicity.

  • Tagging strategy: C-terminal tagging is generally preferred for MFS proteins to avoid interfering with N-terminal signal sequences. Common tags include:

    • GFP for localization studies

    • FLAG, HA, or Myc for immunodetection

    • His6 or Strep-tag for purification

  • Integration method: For stable expression, integrate the construct at a neutral genomic locus (e.g., URA3 or LEU2) using homologous recombination or CRISPR-Cas9.

  • Strain selection: Use strains optimized for membrane protein expression, such as those with deficiencies in specific proteases.

The S-type population construction method described by synthetic recombinant population researchers offers advantages for studying proteins with multiple functional domains or complex regulation, as it allows for better representation of founder genotypes and potentially higher genetic variation in the resulting strains.

What methods are most effective for determining the subcellular localization of YCR023C?

Determining the precise subcellular localization of YCR023C is crucial for understanding its function. Multiple complementary approaches should be employed:

Fluorescence Microscopy Approaches:

  • GFP fusion microscopy: Engineer C-terminal GFP fusions of YCR023C and observe localization patterns in living cells. Co-localize with organelle markers (e.g., ER-tracker, MitoTracker).

  • Immunofluorescence: Use antibodies against epitope-tagged YCR023C versions with appropriate membrane permeabilization protocols optimized for yeast (e.g., zymolyase treatment followed by detergent permeabilization).

Biochemical Fractionation:

  • Differential centrifugation: Separate cellular components based on density, followed by western blotting to detect YCR023C in different fractions.

  • Density gradient ultracentrifugation: Further separate membrane types based on their buoyant density.

Fractionation MethodCentrifugation SpeedExpected YCR023C Location for Different Hypothesized Functions
Nuclear isolation1,500×g, 5 minNuclear membrane (if involved in nucleocytoplasmic transport)
Mitochondrial12,000×g, 10 minMitochondrial membrane (if involved in metabolite transport)
Microsomal100,000×g, 60 minER/Golgi/Vacuolar membranes (if involved in secretory pathway)
Plasma membraneSucrose gradientCell surface (if involved in nutrient uptake)

Proteomics-Based Approaches:

  • Proximity labeling: Use BioID or APEX2 fusions to identify proteins in close proximity to YCR023C, providing clues about its localization and potential interacting partners.

  • Mass spectrometry analysis of purified organelle fractions to confirm the presence of YCR023C.

What genetic approaches can reveal the function of YCR023C?

Several genetic strategies can help elucidate the function of YCR023C:

Gene Deletion and Phenotypic Analysis:

  • Generate a YCR023C deletion strain using CRISPR-Cas9 or homologous recombination.

  • Perform comprehensive phenotypic profiling under various conditions:

    • Different carbon sources

    • Osmotic stress

    • Temperature variations

    • Various drug treatments

    • Nutrient limitations

    • Hypoxic conditions

Synthetic Genetic Array (SGA) Analysis:

  • Cross YCR023C deletion strain with a genome-wide deletion library.

  • Identify genetic interactions (synthetic lethality or rescue).

  • Map YCR023C to specific cellular pathways based on interaction profiles.

Based on studies of other uncharacterized membrane proteins like those in Micrococcus luteus, special attention should be paid to testing phenotypes under hypoxic conditions, as many membrane proteins play crucial roles in oxygen metabolism and stress response .

How can researchers optimize purification of recombinant YCR023C for structural studies?

Purification of membrane proteins like YCR023C presents significant challenges. A systematic approach includes:

Expression Optimization:

  • Test multiple expression systems:

    • S. cerevisiae itself (recommended for native folding)

    • Pichia pastoris (for higher yield)

    • Bacterial systems with specialized membrane protein expression strains

  • Expression construct design:

    • Include fusion partners that enhance stability (GFP, MBP)

    • Engineer thermostabilizing mutations if needed

    • Consider removing flexible regions for crystallization

Purification Protocol:

  • Membrane isolation: Lyse cells using mechanical disruption (glass beads for yeast), followed by differential centrifugation to isolate membrane fractions.

  • Solubilization screening: Test a panel of detergents to identify optimal solubilization conditions:

Detergent ClassExamplesAdvantagesDisadvantages
Mild non-ionicDDM, LMNGMaintains protein structureLess efficient solubilization
ZwitterionicLDAO, FC-12Better solubilizationMay destabilize protein
Newer amphipolsDIBMA, SMAExtracts protein with native lipidsLimited downstream compatibility
  • Affinity purification: Using engineered tags (His6, Strep-tag II).

  • Size exclusion chromatography: To ensure monodispersity and remove aggregates.

  • Stability assessment: Use thermal shift assays to identify buffer conditions that maximize protein stability.

For structural studies, consider reconstitution into nanodiscs or lipid cubic phase for crystallization attempts or prepare samples for cryo-EM analysis if the protein is of sufficient size.

How can researchers determine if YCR023C functions as a transporter and identify its substrates?

As a predicted member of the Major Facilitator Superfamily, YCR023C likely functions as a transporter. The following approaches can help identify its substrates:

In Vivo Transport Assays:

  • Growth-based screens: Test growth of wild-type vs. YCR023C deletion strains on media containing different potential substrates.

  • Toxic substrate resistance/sensitivity: Determine if YCR023C deletion affects resistance to toxic compounds (potential substrates that the transporter may efflux or import).

  • Radioisotope uptake assays: Measure uptake of radiolabeled potential substrates in cells overexpressing or lacking YCR023C.

In Vitro Transport Assays:

  • Liposome reconstitution: Purify YCR023C and reconstitute into proteoliposomes loaded with different buffer conditions.

  • Transport measurement: Monitor substrate transport using:

    • Fluorescent substrate analogs

    • Changes in liposome internal pH (for proton-coupled transporters)

    • Substrate-specific electrodes

Structural Approaches:

  • Computational docking: Use homology models of YCR023C to predict substrate binding pockets and perform virtual screening of potential substrates.

  • Binding assays: Use microscale thermophoresis (MST) or surface plasmon resonance (SPR) to measure direct binding of potential substrates to purified YCR023C.

What transcriptomic approaches can reveal the regulatory network of YCR023C?

Understanding the regulatory context of YCR023C can provide valuable insights into its function:

RNA-Seq Analysis:

  • Compare transcriptomes of wild-type and YCR023C deletion strains under multiple conditions.

  • Identify genes with altered expression when YCR023C is deleted.

Time-Course Expression Analysis:

  • Monitor expression changes of YCR023C and related genes during:

    • Cell cycle progression

    • Response to environmental stresses

    • Metabolic shifts (e.g., diauxic shift)

ChIP-Seq Analysis:

  • Identify transcription factors that bind to the YCR023C promoter region.

  • Map the complete regulatory network controlling YCR023C expression.

Studies of the glyoxylate shunt upregulation in response to genetic modifications, as seen in other S. cerevisiae research , suggest that metabolic compensation mechanisms should be carefully investigated when studying membrane transporters like YCR023C.

How can post-translational modifications of YCR023C be identified and characterized?

Post-translational modifications (PTMs) often regulate membrane protein function and localization. For YCR023C:

PTM Identification Methods:

  • Mass spectrometry: Use targeted MS/MS approaches to identify phosphorylation, ubiquitination, glycosylation, and other modifications. The iPTMnet database indicates YCR023C (P25351) may have PTM sites that could be functionally relevant .

  • Western blot analysis: Use modification-specific antibodies (anti-phospho, anti-ubiquitin) to detect modified forms of tagged YCR023C.

  • Gel mobility shift assays: Observe changes in migration patterns indicative of modifications.

PTM Functional Characterization:

  • Site-directed mutagenesis: Mutate predicted PTM sites to non-modifiable residues and assess functional consequences.

  • Genetic manipulation of modifying enzymes: Delete or overexpress kinases, phosphatases, or other enzymes predicted to modify YCR023C.

  • Temporal dynamics analysis: Determine how PTMs change in response to different conditions or throughout the cell cycle.

How can synthetic recombinant populations be used to study YCR023C function?

Synthetic recombinant populations offer powerful approaches for studying complex traits and gene functions in S. cerevisiae:

Creating Synthetic Populations:

  • Crossing approach selection: Choose between the "K-type" random mating approach or the more controlled "S-type" approach involving careful pairing and tetrad dissection .

  • Founder selection: Incorporate strains with diverse genetic backgrounds (4, 8, or 12 isogenic founders) to maximize genetic diversity in the resulting population .

  • Population maintenance: Perform multiple rounds of outcrossing to increase recombination and genetic diversity.

Experimental Applications:

  • QTL mapping: Identify genetic loci that interact with YCR023C by phenotyping the population for traits of interest.

  • Epistasis analysis: Identify non-additive genetic interactions between YCR023C variants and other loci.

  • Experimental evolution: Subject populations with different YCR023C variants to selective pressures to observe adaptive trajectories.

The S-type population construction method is particularly recommended for studying membrane proteins as it produces populations with more equal founder haplotype representation and consequently higher levels of genetic variation .

What computational approaches can integrate multiple data types to predict YCR023C function?

Integrative computational approaches can synthesize diverse experimental data:

Multi-omics Data Integration:

  • Network analysis: Construct interaction networks combining:

    • Protein-protein interactions

    • Genetic interactions

    • Co-expression patterns

    • Metabolic connections

  • Machine learning approaches: Train algorithms on known membrane protein functions to predict YCR023C function based on multiple features.

  • Evolutionary analysis: Use methods as described in the Karathia et al. study to evaluate which model organisms might share functional conservation of YCR023C homologs .

Visualization and Analysis Tools:

  • Use tools like Cytoscape for network visualization

  • Apply gene set enrichment analysis (GSEA) to identify functional categories overrepresented in YCR023C-related gene sets

  • Implement Bayesian approaches to estimate the probability of different functional assignments

How does YCR023C compare to other uncharacterized membrane proteins in S. cerevisiae?

Comparative analysis with other uncharacterized membrane proteins can reveal patterns and insights:

Systematic Comparison Methods:

  • Phylogenetic classification: Determine evolutionary relationships between YCR023C and other uncharacterized membrane proteins.

  • Domain architecture analysis: Compare structural predictions and conserved domains.

  • Expression pattern clustering: Group proteins with similar expression profiles across conditions.

  • Phenotypic profile comparison: Compare deletion phenotypes of multiple uncharacterized proteins to identify functional clusters.

Similar approaches to those used in characterizing the hypoxic stress response role of uncharacterized membrane proteins in other organisms could be particularly valuable for YCR023C, especially given the importance of oxygen metabolism in yeast and the potential role of membrane proteins in this process.

How can CRISPR-Cas9 technologies be optimized for studying YCR023C?

CRISPR-Cas9 offers versatile approaches for studying YCR023C function:

Advanced CRISPR Applications:

  • CRISPRi/CRISPRa: Use catalytically inactive Cas9 (dCas9) fused to repressors (CRISPRi) or activators (CRISPRa) to modulate YCR023C expression without genetic modification.

  • Base editing: Introduce specific point mutations in YCR023C without double-strand breaks using Cas9-cytidine or Cas9-adenine deaminase fusions.

  • Prime editing: Perform precise edits to YCR023C using Cas9 fused to reverse transcriptase.

  • CRISPR scanning: Systematically target different regions of YCR023C with guide RNAs to identify functional domains.

Optimization Strategies for Yeast:

  • Guide RNA design: Use yeast-specific algorithms that account for chromatin structure and nucleosome positioning.

  • Delivery methods: Optimize transformation protocols specifically for S. cerevisiae.

  • Cas9 expression: Use yeast-optimized Cas9 variants with appropriate promoters for precise temporal control.

What proteomics approaches can reveal YCR023C interaction partners and dynamics?

Advanced proteomics methods provide powerful tools for characterizing YCR023C:

Interaction Mapping Techniques:

  • Proximity labeling: Use BioID or APEX2 fusions to identify proteins in close proximity to YCR023C in living cells.

  • Cross-linking mass spectrometry (XL-MS): Identify interaction interfaces by cross-linking followed by MS analysis.

  • Co-immunoprecipitation coupled with MS: Identify stable interaction partners.

Dynamics and Structural Analysis:

  • Hydrogen-deuterium exchange MS (HDX-MS): Map conformational changes in YCR023C under different conditions.

  • Limited proteolysis: Identify accessible regions and domain boundaries.

  • Native MS: Analyze intact complexes containing YCR023C to determine stoichiometry and stability.

How might YCR023C research contribute to broader understanding of membrane protein evolution?

Research on YCR023C can provide valuable insights into membrane protein evolution:

Evolutionary Analysis Approaches:

  • Sequence-based phylogenetics: Trace the evolutionary history of YCR023C across fungal species and identify selective pressures.

  • Structural conservation mapping: Identify conserved structural elements that may indicate functional importance.

  • Horizontal gene transfer analysis: Determine if YCR023C has been horizontally transferred between fungal lineages.

  • Comparative analysis with bacterial homologs: Identify potential evolutionary connections with bacterial membrane proteins.

This research aligns with broader studies on how model organisms like S. cerevisiae can serve as proxies for understanding membrane protein function in more complex organisms . The methods developed by Karathia et al. could be applied to determine which organisms would benefit most from YCR023C functional characterization in S. cerevisiae as a model system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.