Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YGR016W (YGR016W)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Interactions

YGR016W participates in multiple genetic networks:

  • Negative genetic interaction with ARL3 (SGA score = -0.1354), a GTPase involved in Golgi apparatus function .

  • Physical association with Ssa2p, an Hsp70-family chaperone implicated in protein folding and vacuolar transport .

  • Membership in Class 2 MAGIC regulators, linking it to mitochondrial protein quality control pathways .

Table 2: Validated Interaction Partners

InteractorInteraction TypeFunctional Role of PartnerSource
ARL3Negative geneticGolgi membrane trafficking
SSA2Affinity capture-MSProtein folding chaperone
RTK1Predicted functionalSerine/threonine kinase activity

Recombinant Production and Applications

The recombinant YGR016W protein (CSB-CF344863SVG) is commercially produced using an E. coli expression system . Key specifications include:

  • Expression system: In vitro bacterial synthesis with codon optimization for solubility.

  • Purity: >85% (SDS-PAGE verified).

  • Applications: Membrane protein studies, antibody production, and interaction screening .

Research Implications

Despite its uncharacterized function, YGR016W’s interactions suggest roles in:

  1. Membrane trafficking: Association with Arl3p implicates involvement in vesicle docking .

  2. Stress response: Interaction with Ssa2p connects it to heat shock protein networks .

  3. Mitochondrial regulation: MAGIC phenotype classification indicates potential quality control functions .

Knowledge Gaps and Future Directions

Current limitations include:

  • No resolved 3D structure or enzymatic activity data.

  • Unclear physiological role in S. cerevisiae under standard growth conditions .

  • Limited in vivo validation of predicted membrane localization.

Ongoing studies focus on CRISPR-based knockout phenotyping and cryo-EM structural analysis to elucidate mechanistic details.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our stock. However, if you have a specific format preference, kindly indicate your requirement when placing the order. We will do our best to accommodate your request.
Lead Time
The delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for a maximum of one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag type.
Synonyms
YGR016W; Uncharacterized membrane protein YGR016W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR016W
Target Protein Sequence
MSRLRRFNRKILSLSSDYTHDGESDQEDVSILPLDTEEQEELIQKFETNAHITNKLYINL LSILYLLYGGLLMILVRKSRGYIKLALLAGANSLICSCITLRYDIVNDYLLFKKFKLRVS NFSINIINIILLVLMAWISFNHVVEDKKTVLCLQVPMFLFWVAVLVKRWARNIEDEIADL RCLKYKYKNA
Uniprot No.

Target Background

Database Links

KEGG: sce:YGR016W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YGR016W and why is it significant for research?

YGR016W is an uncharacterized membrane protein in the model organism Saccharomyces cerevisiae. Studying uncharacterized membrane proteins is important because they may have roles in essential cellular processes that remain undiscovered. S. cerevisiae is an excellent model system for such studies because it combines the advantages of unicellular organisms (easy genetic manipulation, rapid growth) with eukaryotic post-translational modifications. Furthermore, as a eukaryotic organism with GRAS (Generally Recognized As Safe) status, findings may have translational potential to higher organisms .

What expression systems are recommended for studying YGR016W?

For studying YGR016W, S. cerevisiae itself serves as an ideal expression system. The organism offers several advantages:

  • Cost-effectiveness compared to more complex eukaryotic systems

  • Capacity to reach high cell densities rapidly

  • Ability to produce high protein yields

  • Capability to perform proper eukaryotic post-translational modifications

  • Correct folding and targeting of integral membrane proteins

Using chimeric shuttle vectors with GAL1 promoters can provide controlled expression of the protein for various experimental purposes .

How can I determine the subcellular localization of YGR016W?

To determine subcellular localization of membrane proteins like YGR016W, consider these methodological approaches:

  • Fluorescent protein fusion: Create a genomically encoded protein A chimera or GFP fusion of YGR016W and use fluorescence microscopy to visualize its location

  • Co-localization studies: Use markers for various cellular compartments (like DsRed-PTS1 for peroxisomes) to identify where the protein resides

  • Subcellular fractionation: Separate cellular components through differential centrifugation (PNS, 20KgS, 20KgP fractions)

  • Immunoblotting: Track the protein in different cellular fractions

  • Density gradient centrifugation: Further purify organelles and analyze protein distribution

These approaches, similar to those used for characterizing proteins like Yhr150p and Ydr479p, can help determine if YGR016W localizes to peroxisomes, mitochondria, or other cellular compartments .

What strategies can be used to determine if YGR016W is an integral membrane protein?

Determining if YGR016W is an integral membrane protein requires several experimental approaches:

  • Sequence analysis: Use prediction algorithms like TMHMM (http://www.cbs.dtu.dk/services/TMHMM-2.0/) to identify potential transmembrane helices.

  • Membrane extraction assays: Apply the following protocol:

    • Isolate organellar fractions containing the protein

    • Treat with alkali sodium carbonate (pH 11.5)

    • Centrifuge to separate soluble and membrane fractions

    • Analyze distribution by immunoblotting

    Integral membrane proteins will remain in the pellet fraction, while peripheral membrane proteins will be found in the supernatant .

  • Protease protection assays: Determine topology by testing which protein domains are protected from protease digestion.

TreatmentExpected Result for Integral Membrane ProteinsExpected Result for Peripheral Proteins
Buffer onlyFull-length proteinFull-length protein
Na₂CO₃ (pH 11.5)Remains in pelletMoves to supernatant
Triton X-100 + ProteaseComplete digestionComplete digestion
Protease onlyPartial digestionVariable digestion

How can I optimize YGR016W expression in S. cerevisiae?

Optimizing expression of membrane proteins like YGR016W requires addressing several factors:

  • Strain selection: Consider using protease-deficient strains like W303-Δpep4 to minimize protein degradation .

  • Growth conditions optimization:

    • Temperature: Lower temperatures (20-25°C) often improve membrane protein folding

    • Media composition: YPD for initial growth, followed by induction media

    • Carbon source: Use galactose for GAL1 promoter induction

    • Growth phase: Induce at early-mid log phase (OD₆₀₀ = 0.8-1.0)

  • Expression vector optimization:

    • Promoter strength: GAL1 provides strong, controllable expression

    • Codon optimization: Adjust codons to match S. cerevisiae preference

    • Fusion tags: Consider C-terminal tags as N-terminal tags may interfere with membrane insertion

  • Harvest timing: Optimal protein yields typically occur 12-18 hours post-induction .

What are the challenges in purifying YGR016W and how can they be addressed?

Purification of membrane proteins like YGR016W presents several challenges:

  • Solubilization: Test multiple detergents at various concentrations:

    • Mild detergents (DDM, LMNG, Digitonin): Start with these to maintain protein structure

    • Stronger detergents (LDAO, FC-12): Use if milder options fail

    • Lipid-detergent mixtures: Can stabilize the protein during extraction

  • Purification strategy:

    • Affinity chromatography: Use His or FLAG tags for initial capture

    • Size exclusion chromatography: Remove aggregates and detergent micelles

    • Ion exchange: Further purify based on surface charge

  • Stability enhancement:

    • Add cholesterol or specific lipids

    • Include glycerol (10-15%) in buffers

    • Maintain cold temperatures throughout

  • Yield assessment: Develop Western blot protocols with appropriate controls to accurately quantify protein at each purification step.

How can I determine functional associations for the uncharacterized protein YGR016W?

For determining functional associations of YGR016W, implement these advanced approaches:

  • Gene deletion/knockout analysis:

    • Create YGR016W deletion strains using homologous recombination

    • Perform comprehensive phenotypic analysis under various conditions

    • Look for changes in peroxisome number, size, and distribution, as observed with deletion of other membrane proteins like YHR150w (PEX28) and YDR479c (PEX29)

  • Suppressor/enhancer genetic screens:

    • Identify genes that when overexpressed rescue the YGR016W deletion phenotype

    • Similar to how PEX25 or VPS1 overexpression restored wild-type peroxisome morphology in YHR150w/YDR479c deletions

  • Protein-protein interaction studies:

    • Perform split-ubiquitin yeast two-hybrid analysis (specifically designed for membrane proteins)

    • Conduct co-immunoprecipitation with crosslinking to capture transient interactions

    • Use proximity labeling methods (BioID or APEX) to identify neighboring proteins

  • Transcriptome analysis:

    • Compare gene expression profiles between wild-type and ΔYgr016w strains

    • Look for clusters of co-regulated genes to identify potential pathways

What approaches can be used to investigate membrane topology and structure of YGR016W?

Investigating membrane topology and structure of YGR016W requires sophisticated techniques:

  • Cysteine scanning mutagenesis and accessibility assays:

    • Introduce cysteine residues throughout the protein sequence

    • Test accessibility to membrane-impermeable thiol-reactive reagents

    • Map regions exposed to cytosol versus lumen/extracellular space

  • Limited proteolysis with mass spectrometry:

    • Partially digest purified protein

    • Identify protected fragments by MS

    • Determine domain boundaries and exposed regions

  • Structural analysis techniques:

    • Cryo-electron microscopy: For medium to high-resolution structure

    • X-ray crystallography: Challenging but possible with stabilized protein

    • NMR spectroscopy: For dynamic regions or smaller domains

  • Computational modeling combined with experimental validation:

    • Generate structural models using homology modeling and AI-based prediction

    • Test key predictions experimentally (e.g., mutation of predicted functional residues)

    • Refine models iteratively based on experimental data

How can I resolve discrepancies in data when characterizing YGR016W?

When facing contradictory results in YGR016W characterization, implement these analytical approaches:

  • Experimental condition analysis:

    • Evaluate how growth conditions affect protein expression and localization

    • Test if protein behavior changes under different stress conditions

    • Consider that membrane proteins may relocalize under specific cellular states

  • Technical variation assessment:

    • Compare results using different epitope tags and their positions

    • Validate antibody specificity with appropriate controls

    • Assess if the detection method influences observations (e.g., direct fluorescence vs. immunofluorescence)

  • Strain background evaluation:

    • Test the protein in multiple S. cerevisiae strain backgrounds

    • Consider genetic interactions that may be strain-dependent

    • Assess if auxotrophies or mutations in laboratory strains affect results

  • Temporal resolution:

    • Analyze protein dynamics through time-course experiments

    • Consider cell cycle effects on membrane protein distribution

    • Determine if discrepancies reflect different capture times of dynamic processes

How can CRISPR-Cas9 genome editing be applied to study YGR016W?

CRISPR-Cas9 offers sophisticated approaches for studying YGR016W:

  • Precise genomic modifications:

    • Create point mutations to test specific residues for function

    • Introduce fluorescent tags at the endogenous locus

    • Generate conditional alleles (degron tags, auxin-inducible degrons)

  • Regulatory element engineering:

    • Modify promoter strength to test dosage effects

    • Create inducible versions of the endogenous gene

    • Insert reporter constructs to monitor expression

  • Multiplex editing:

    • Simultaneously modify YGR016W and potential interacting partners

    • Create libraries of variants for high-throughput functional screening

    • Implement synthetic genetic array-like approaches with CRISPR

  • Validation strategy:

    • Design multiple guide RNAs to control for off-target effects

    • Implement rescue experiments with wild-type constructs

    • Use whole-genome sequencing to verify edit specificity

What omics approaches can provide insights into YGR016W function?

Integrating multiple omics approaches can reveal YGR016W function:

  • Multi-omics integration strategy:

Omics ApproachApplication to YGR016WExpected Insights
ProteomicsQuantitative analysis of ΔYgr016w vs. wild-typeChanges in protein abundance and modified proteins
LipidomicsMembrane lipid composition analysisAlterations in membrane structure and organelle integrity
MetabolomicsMetabolite profilingDisrupted metabolic pathways
TranscriptomicsRNA-seq of deletion mutantsCompensatory gene expression changes
InteractomicsAP-MS or BioIDProtein interaction network
  • Spatial omics considerations:

    • Perform subcellular fractionation before omics analysis

    • Consider organelle-specific changes that might be diluted in whole-cell analyses

    • Implement proximity labeling approaches to identify spatial protein communities

  • Temporal omics dynamics:

    • Analyze changes across growth phases

    • Implement pulse-labeling approaches for protein turnover

    • Study stress responses over time

  • Data integration methodology:

    • Use systems biology approaches to integrate multiple data types

    • Apply machine learning for pattern recognition across datasets

    • Validate key predictions with targeted biochemical experiments

How might YGR016W function be related to membrane dynamics and organelle biogenesis?

Based on studies of other membrane proteins in S. cerevisiae, YGR016W might participate in membrane dynamics:

  • Potential roles in organelle biogenesis:

    • Regulation of organelle number and size (similar to PEX28/PEX29)

    • Membrane contact site formation between organelles

    • Lipid transfer between membrane compartments

    • Organelle inheritance during cell division

  • Experimental approaches to test these hypotheses:

    • Electron microscopy to analyze ultrastructural changes in deletion mutants

    • Live-cell imaging to track organelle dynamics

    • Lipidomics to identify changes in membrane composition

    • Genetic interaction mapping with known membrane dynamics factors

  • Consideration of functional redundancy:

    • Identify proteins with similar structural features or expression patterns

    • Create multiple deletions to overcome potential redundancy

    • Test overexpression effects on different organelle parameters

  • Protein targeting machinery interaction:

    • Investigate dependence on different protein import pathways

    • Analyze post-translational modifications that might regulate targeting

    • Determine if YGR016W itself contributes to the targeting of other proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.