Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YGR149W (YGR149W)

Shipped with Ice Packs
In Stock

Description

Structure and Sequence

YGR149W is a 432-amino acid protein (UniProt: P48236) annotated as an uncharacterized integral membrane protein . Key structural features include:

  • Transmembrane domains: Predicted to contain eight transmembrane helices, as inferred from homology-based modeling .

  • Sequence homology: Shares domain similarities with glycerophosphocholine acyltransferases (GPCATs) in lipid metabolism pathways .

ParameterValueSource
Length (AA)432
Molecular WeightNot explicitly reported
Isoelectric PointNot explicitly reported

Biophysical Properties

Limited experimental data exist, but key insights include:

  • Half-life: ~20.85 hours (0.8689 days) under standard conditions .

  • Stability: Recombinant YGR149W is stored in Tris-based buffer with 50% glycerol at -20°C .

PropertyDescriptionSource
Protein StabilitySensitive to repeated freeze-thaw cycles
Storage BufferTris-based, 50% glycerol

Toxicity and Overexpression

YGR149W was identified in a genome-wide screen as a growth-impairing protein when overexpressed in S. cerevisiae. Full-length YGR149W exhibited reduced toxicity compared to truncated or antisense variants .

Study DesignFindingSource
Tet-off promoter screenFull-length YGR149W less toxic than truncated variants
Membrane localizationIntegral membrane protein

Lipid Metabolism

Recent studies reclassified YGR149W as GPC1 (glycerophosphocholine acyltransferase), linking it to lipid processing:

  • GPC1 function: Catalyzes the transfer of acyl groups to glycerophosphocholine, influencing membrane lipid composition .

  • Complementation: Deletion of GPC1 (YGR149W) in S. cerevisiae reduced membrane incorporation of radiolabeled glycerophosphocholine, restored by plasmid-borne GPC1 .

Interactions and Pathways

BioGRID reports 118 interactions for YGR149W, though functional pathways remain unclear . Predicted roles include:

  • Membrane trafficking: Based on domain similarities to transport proteins (e.g., OPT, FUI1) .

  • Regulatory networks: Interacts with proteins involved in transcriptional regulation and vesicle trafficking .

Interaction TypeExamplesSource
Protein-protein115 interactors (e.g., WD40-repeat proteins)
Regulatory networksPotential role in membrane dynamics

Expression and Localization

  • Localization: GFP-tagged YGR149W shows membrane localization in fluorescence microscopy .

  • Expression systems: Inducible expression under the GAL1 promoter in S. cerevisiae .

Recombinant Production

Recombinant YGR149W is commercially available:

ParameterDetailsSource
HostE. coli
TagHis-tag
Purity≥95% (typically)
ApplicationsELISA, protein interaction studies

Research Applications

YGR149W serves as a model for studying:

  1. Membrane protein toxicity: Mechanisms of growth impairment upon overexpression .

  2. Lipid metabolism: Role in glycerophosphocholine acylation and membrane lipid homeostasis .

  3. Protein localization: Membrane insertion and stability using recombinant variants .

Gaps and Future Directions

  • Functional ambiguity: Despite recent links to GPCAT activity, YGR149W’s precise biochemical role remains unresolved.

  • Structural studies: High-resolution structures are needed to clarify transmembrane domain arrangements.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that specific requirements may exist. If you need a particular format, please indicate it in your order notes and we will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery information.
Note: Our default shipping method utilizes standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes 50% glycerol, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal quality and minimize degradation, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While we strive to select the most suitable tag type during production, we welcome specific tag requests. Please inform us of your preferred tag, and we will prioritize its development if feasible.
Synonyms
GPC1; YGR149W; G6639; Glycerophosphocholine acyltransferase 1; GPCAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-432
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR149W
Target Protein Sequence
MYKLDNNDIDDETNNSVSLTSLLEFLDPIASKVVSKYYHGSHLSKAEQKLRNFEGFRRRK PHHEHDSHHPHHLNRSRSFLQLEDFKVRALQRIRNLDKPLDSIFFKNSSRLEKAFYPFTL FNIFFIGFLMGRFPEWFHVYYTILFFVLMPIRFYTYYKTKNHYFLADFCYFVNMLCLLFI WIFPYSYSLFQSCFAFTFGTLCFAVITWRNSLVIHSIDKTTSCFIHIIPPCVMYVIYHGL PLEYKIERFPGAIIQSELDIKKNILWTSLYYLVWQSLYHYFITLKKSSKIKSGERMTSFE YLTTHQFKNFWAVKLRSPWPMIIYTLSQYFYQLFTMLLCGIWIRYKLAAALFLTIVFLWA SHNGATYYIDHYGKNFEKEVDRLRLEVENLQQKLQPDSDAVISDASVNDKDYLNVNRDED FDDSSSVSSKSD
Uniprot No.

Target Background

Function
Glycerophosphocholine acyltransferase (GPCAT) plays a crucial role in lipid metabolism by utilizing acyl-CoA to acylate glycero-3-phosphocholine (GPC), thereby producing lysophosphatidylcholine (LPC). This enzyme exhibits broad acyl specificities, favoring 16:0-CoA, polyunsaturated acyl-CoA, and the hydroxylated ricinoleoyl-CoA. Additionally, GPCAT catalyzes the acylation of glycero-3-phosphoethanolamine (GPE) using acyl-CoA as a substrate. Beyond acyl-CoA, GPCAT efficiently utilizes LPC and lysophosphatidylethanolamine (LPE) as acyl donors in the acylation of GPC. This enzyme contributes to the maintenance of phosphatidylcholine (PC) homeostasis and may also have specific functions in acyl editing of PC. This process involves the transfer of acyl groups modified at the sn-2 position of PC to the sn-1 position. GPCAT is implicated in postsynthetic PC remodeling, leading to the production of more saturated PC species.
Gene References Into Functions
  1. In vivo labeling studies have confirmed the role of Gpc1p in PC biosynthesis in yeast. It is hypothesized that GPCATs contribute to the maintenance of phosphatidylcholine (PC) homeostasis and also have specific functions in acyl editing of PC. For instance, they may transfer acyl groups modified at the sn-2 position of PC to the sn-1 position of this molecule in plant cells. PMID: 27758859
Database Links

KEGG: sce:YGR149W

STRING: 4932.YGR149W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the functional role of YGR149W in Saccharomyces cerevisiae?

YGR149W is an uncharacterized membrane protein in Saccharomyces cerevisiae with limited functional annotation. Current research suggests it may be involved in stress response pathways, particularly those mediated by the Hog1 MAP kinase. The protein shows a moderate fold change (2.45) during osmotic stress conditions, indicating its potential role in cellular adaptation to environmental changes . While its precise biological function remains undefined, the protein's differential expression patterns suggest it may contribute to cellular homeostasis during stress conditions. Researchers should consider its membrane localization when designing experimental approaches to elucidate its function.

What expression systems are most effective for producing recombinant YGR149W protein?

Multiple expression systems can be utilized for producing recombinant YGR149W protein, including prokaryotic (E. coli), yeast (Saccharomyces cerevisiae), mammalian, and insect cell systems . For membrane proteins like YGR149W, eukaryotic expression systems often provide better folding environments and post-translational modifications. Specific yeast host strains such as SMD1168, GS115, and X-33 have been successfully employed for membrane protein expression . For researchers seeking high yield with proper folding, a homologous expression approach using Saccharomyces cerevisiae is recommended to maintain native conditions. When expressing in heterologous systems, codon optimization should be considered to enhance expression efficiency.

How can researchers verify the correct folding and functionality of recombinant YGR149W?

Verification of correct folding and functionality of recombinant YGR149W requires a multi-faceted approach. Begin with biophysical characterization using circular dichroism to assess secondary structure integrity. For membrane proteins like YGR149W, detergent solubilization profiles can indicate proper folding. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can confirm monodispersity and appropriate oligomeric state. Functional verification may include complementation assays in yeast strains with YGR149W deletions, observing whether the recombinant protein restores wild-type phenotypes. Additionally, since YGR149W shows a 2.45-fold change in Hog1 MAP kinase pathway activation , researchers can verify functionality by measuring stress response in reconstituted systems or cell-based assays following osmotic challenges.

What are the optimal conditions for studying YGR149W overexpression phenotypes?

To study YGR149W overexpression phenotypes, researchers should implement a regulated expression system such as the tetracycline-regulatable promoter system used in previous studies . This approach allows for tight control of expression levels. Based on the reported data, YGR149W demonstrates mild toxicity when overexpressed, with its full-length version being less toxic than truncated forms . For optimal experimental design, use a centromeric or episomal vector system with a selection marker (URA3 or TRP1) and conduct experiments in synthetic complete medium lacking the appropriate nutrient to maintain selection pressure . Include doxycycline (10 μg/ml) for uninduced conditions and remove it to induce overexpression. Monitor growth phenotypes at 30°C, comparing uninduced versus overexpression conditions across multiple independent transformants (recommended minimum of seven) to ensure reproducibility . Include appropriate controls such as empty vector and known toxic genes (e.g., MCM1) to validate the experimental system.

How can researchers effectively generate truncated versions of YGR149W for functional domain analysis?

For effective generation of truncated versions of YGR149W for functional domain analysis, researchers should employ a systematic approach based on predicted structural domains. First, conduct bioinformatic analysis using transmembrane prediction algorithms to identify membrane-spanning regions and potential functional domains. Based on previous findings that truncated YGR149W exhibits increased toxicity compared to the full-length protein , researchers should create a series of N-terminal and C-terminal truncations using PCR-based methods with primers designed to amplify specific regions while maintaining the reading frame. These truncated sequences should be cloned into expression vectors containing an in-frame epitope tag (such as HA-tag) to facilitate detection . Generate constructs with varying truncation points to systematically identify functional domains. Each construct should be transformed into an appropriate yeast strain (such as FYBL2-5D) using a regulatable promoter system to control expression levels . Phenotypic analysis should include growth rate measurements, microscopic examination of cellular morphology, and protein localization studies using the epitope tag. Complementary approaches such as yeast two-hybrid screening with the truncated versions can help identify interaction partners specific to different domains.

What methodologies are recommended for studying protein-protein interactions involving YGR149W?

For studying protein-protein interactions involving the membrane protein YGR149W, a multi-layered approach is recommended. Begin with proximity-based labeling techniques such as BioID or APEX2, where the enzyme is fused to YGR149W, allowing for biotinylation of proximal proteins in living cells. This is particularly valuable for membrane proteins where traditional methods may disrupt weak or transient interactions. Complementary approaches should include split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins, which allow for interaction detection without requiring nuclear localization. For validation, co-immunoprecipitation using mild detergents (such as digitonin or DDM) that preserve membrane protein complexes should be performed, coupled with mass spectrometry identification. Given YGR149W's association with the Hog1 MAP kinase pathway (fold change 2.45) , researchers should specifically examine interactions under osmotic stress conditions, comparing normal and stress states to identify condition-specific binding partners. Additionally, bimolecular fluorescence complementation (BiFC) can provide spatial information about where in the cell these interactions occur, which is particularly relevant for determining if YGR149W interactions are membrane-localized or occur in other cellular compartments during stress responses.

What genetic approaches can be used to characterize the function of YGR149W?

To characterize the function of YGR149W, researchers should implement a comprehensive genetic toolkit. Begin with precise gene deletion using homologous recombination to create ΔYGR149W strains, followed by phenotypic profiling under various stress conditions, particularly osmotic stress given its association with the Hog1 pathway . Complementation studies with the wild-type gene can confirm phenotype specificity. For more nuanced functional insights, construct conditional mutants using degron tags or temperature-sensitive alleles to enable temporal control of protein depletion. Genetic interaction mapping via synthetic genetic array (SGA) analysis will identify genes that functionally interact with YGR149W, potentially revealing its pathway membership. Given that YGR149W shows differential toxicity between full-length and truncated forms , domain-specific mutagenesis targeting conserved residues can pinpoint functional regions. For in vivo relevance, construct fluorescent protein fusions to monitor localization patterns during normal growth and stress conditions, while ensuring the tags don't disrupt function. Finally, multicopy suppressor screens, where YGR149W is overexpressed in strains with various gene deletions, can identify downstream components that, when overexpressed, rescue phenotypes associated with YGR149W overexpression toxicity.

How does YGR149W expression change under different stress conditions?

YGR149W demonstrates significant expression changes under specific stress conditions, particularly those activating the Hog1 MAP kinase pathway. In osmotic stress experiments, YGR149W exhibits a 2.45-fold upregulation , placing it among the moderately induced genes in this pathway. To comprehensively characterize its expression profile, researchers should implement time-course RNA-Seq or microarray analysis under various stress conditions including osmotic stress (0.4M NaCl), oxidative stress (hydrogen peroxide), heat shock, nutrient limitation, and cell wall stress. qRT-PCR validation should be performed for precise quantification, using stable reference genes such as ACT1 or TAF10. For protein-level validation, western blotting with specific antibodies or epitope-tagged versions can confirm that transcriptional changes translate to protein abundance alterations. Comparison with known stress-responsive genes can provide context for YGR149W's role in stress adaptation networks. Additionally, analyzing expression in mutants lacking key stress-responsive transcription factors (e.g., Hot1, Sko1, Msn2/4) can help elucidate the regulatory mechanisms controlling YGR149W expression under different conditions, further clarifying its position in stress response pathways.

What is known about the evolutionary conservation of YGR149W across fungal species?

The evolutionary conservation of YGR149W across fungal species remains relatively unexplored but provides valuable insights into its functional significance. Comparative genomic analyses should begin with BLAST searches against fungal genome databases, focusing on both closely related Saccharomyces species and more distant ascomycetes and basidiomycetes. Current data suggests moderate conservation within the Saccharomycetaceae family, with sequence divergence increasing in more distantly related fungi. When analyzing conservation, researchers should pay particular attention to transmembrane domains, which often show higher conservation than loop regions in membrane proteins. Phylogenetic analysis can reveal whether YGR149W underwent gene duplication events or specialized adaptation in specific fungal lineages. Synteny analysis examining the conservation of genomic context around YGR149W can provide additional evolutionary insights, potentially revealing functional associations through genomic clustering. For functional validation of conserved roles, complementation studies introducing orthologs from other fungal species into S. cerevisiae ΔYGR149W strains can determine if the function is preserved across evolutionary distance. This comprehensive evolutionary analysis may reveal whether YGR149W represents a fungal-specific adaptation or a more broadly conserved cellular component, informing hypotheses about its fundamental biological role.

How can structural biology approaches be applied to study YGR149W?

For structural characterization of the membrane protein YGR149W, researchers should implement a multi-technique approach tailored to membrane proteins. Begin with protein expression optimization in eukaryotic systems, particularly yeast or insect cells, utilizing fusion tags such as His, FLAG, or MBP to facilitate purification . For initial structural screening, circular dichroism and thermal stability assays can assess secondary structure content and stability in various detergent environments. Given the challenges of membrane protein crystallization, cryo-electron microscopy (cryo-EM) represents a promising approach, particularly if YGR149W forms homo-oligomeric structures. Sample preparation should focus on detergent selection or reconstitution into nanodiscs or lipid cubic phase systems to maintain native-like lipid environments. For higher resolution insights, X-ray crystallography remains valuable, though requiring extensive crystallization condition screening with various detergents, lipids, and stabilizing mutations. Complementary approaches include hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamic regions and solvent accessibility, and solid-state NMR for specific structural questions about membrane topology. Computer-aided structure prediction using AlphaFold2, particularly with custom templates from homologous proteins, can provide initial structural models to guide experimental design. Together, these approaches can reveal the structural basis for YGR149W function, including potential ligand-binding sites or interaction interfaces relevant to its role in stress response pathways.

What are the most effective approaches for studying the membrane topology of YGR149W?

To effectively characterize the membrane topology of YGR149W, researchers should implement a comprehensive experimental strategy that integrates complementary methods. Begin with computational predictions using multiple topology prediction algorithms (TMHMM, TOPCONS, Phobius) to generate initial models identifying potential transmembrane domains. For experimental validation, systematic cysteine scanning mutagenesis combined with membrane-impermeable thiol-reactive reagents can determine which residues are accessible from different cellular compartments. Alternatively, employ the substituted cysteine accessibility method (SCAM) to map transmembrane segments with precision. Fusion protein approaches using reporter enzymes (such as alkaline phosphatase or beta-galactosidase) at various positions throughout the protein sequence can identify cytoplasmic versus extracellular/lumenal domains based on enzymatic activity. For high-resolution insights, introduce minimal epitope tags (HA, FLAG, c-Myc) at predicted loop regions and assess their accessibility through immunofluorescence microscopy under permeabilized and non-permeabilized conditions. Protease protection assays using microsomal preparations can further validate domain orientation. Advanced approaches include site-directed fluorescence labeling combined with quenchers on different membrane sides, or mass spectrometry-based limited proteolysis to identify accessible regions. Together, these methods will generate a comprehensive topological map of YGR149W, essential for understanding its functional organization and interaction potential within the membrane environment.

How can systems biology approaches integrate YGR149W into cellular pathway models?

To integrate YGR149W into cellular pathway models using systems biology approaches, researchers should implement a multi-omics strategy that captures its functional context. Begin with transcriptomic profiling comparing wild-type and ΔYGR149W strains under various stress conditions, particularly osmotic stress given its 2.45-fold change in the Hog1 pathway . This should be complemented with phosphoproteomic analysis to identify signaling changes influenced by YGR149W absence or overexpression. For protein interaction networks, employ proximity labeling techniques like BioID optimized for membrane proteins, followed by quantitative proteomics to identify YGR149W's protein neighborhood. Metabolomic profiling can reveal metabolic alterations resulting from YGR149W perturbation, potentially identifying pathway endpoints affected by its function. These multi-omics datasets should be integrated using computational methods such as weighted gene co-expression network analysis (WGCNA) or Bayesian network inference to position YGR149W within cellular signaling and metabolic networks. Flux balance analysis incorporating YGR149W-dependent constraints can predict its impact on cellular metabolism. For causal relationship validation, perform targeted perturbation experiments guided by the network models, using CRISPR interference or conditional expression systems. Time-resolved data collection during stress responses can capture dynamic network reorganization involving YGR149W. Finally, compare network models across different yeast species expressing YGR149W orthologs to identify evolutionarily conserved pathway relationships, strengthening confidence in the functional positioning of this uncharacterized membrane protein within the cellular system.

What are the main challenges in expressing and purifying YGR149W for biochemical studies?

Expressing and purifying membrane proteins like YGR149W presents several significant challenges for biochemical studies. First, overexpression often leads to toxicity, as demonstrated by YGR149W's growth inhibition effects when overexpressed . This necessitates careful regulation using inducible promoter systems with tunable expression levels. Second, proper folding and membrane insertion are critical; researchers should consider using homologous expression systems (Saccharomyces cerevisiae) or specialized eukaryotic hosts (insect or mammalian cells) that provide appropriate membrane biogenesis machinery . Third, extraction from membranes requires optimization of detergent conditions; screen multiple detergent types (maltoside, glucoside, and fos-choline series) at various concentrations to identify conditions that maintain protein stability while efficiently solubilizing from membranes. Fourth, purification strategies should incorporate affinity tags (His, FLAG, or MBP) positioned to avoid interference with membrane topology . Fifth, protein stability during purification can be enhanced by including appropriate lipids, cholesterol analogs, or stabilizing ligands in purification buffers. For functional studies, consider reconstitution into nanodiscs or liposomes to provide a native-like membrane environment. Finally, quality control is essential; employ analytical techniques including size exclusion chromatography, dynamic light scattering, and thermal stability assays to verify homogeneity, monodispersity, and proper folding throughout the purification process.

How can researchers differentiate between direct and indirect effects when studying YGR149W overexpression toxicity?

Differentiating between direct and indirect effects of YGR149W overexpression toxicity requires a systematic approach combining genetic, biochemical, and temporal analyses. First, implement a titratable expression system with doxycycline-regulated promoters to establish a dose-response relationship between YGR149W expression levels and growth inhibition . Second, perform time-course transcriptomic and proteomic analyses following induction to identify early versus late response genes, with immediate changes more likely representing direct effects. Third, utilize truncation and point mutation variants of YGR149W to identify specific domains or residues responsible for toxicity ; if specific mutations abolish toxicity without affecting expression or localization, the affected interactions are likely direct causes of toxicity. Fourth, conduct genetic suppressor screens to identify genes that when overexpressed or deleted mitigate YGR149W toxicity, revealing pathways directly impacted. Fifth, employ chemical genetic approaches using compound libraries to identify molecules that specifically suppress YGR149W toxicity, providing insights into affected cellular processes. Sixth, perform microscopy studies immediately following induction to observe subcellular changes (membrane integrity, organelle morphology) that precede growth inhibition. Finally, compare the toxic effect profile of YGR149W with known membrane protein toxicity mechanisms (such as ER stress, membrane permeabilization, or disruption of specific transporters) to identify shared patterns. This comprehensive approach will distinguish primary toxic effects from secondary cellular responses, providing mechanistic insights into how this membrane protein disrupts cellular homeostasis when overexpressed.

What experimental controls are critical when researching an uncharacterized protein like YGR149W?

When researching an uncharacterized protein like YGR149W, implementing rigorous experimental controls is essential for generating reliable and interpretable results. First, genetic controls should include precise gene deletion strains (ΔYGR149W) created using marker-free methods to avoid polar effects on neighboring genes, complemented with wild-type gene reintroduction to confirm phenotype reversibility. Second, expression controls are critical; when studying overexpression phenotypes, include both empty vector controls and a well-characterized control gene (such as MCM1) with known phenotypes to validate experimental systems. Third, protein tagging controls should verify that epitope or fluorescent tags do not disrupt function by demonstrating complementation of knockout phenotypes with the tagged version. Fourth, specificity controls using point mutants or truncation variants help attribute observed phenotypes to specific protein regions; particularly important given YGR149W's differential toxicity between full and truncated forms . Fifth, strain background controls are essential; phenotypes should be confirmed in multiple genetic backgrounds to distinguish protein-specific effects from strain-specific artifacts. Sixth, environmental controls should systematically vary conditions (temperature, media composition, stress factors) with appropriate vehicle controls for any added compounds. Finally, temporal controls involving time-course analyses help distinguish primary from secondary effects, particularly important for stress-responsive proteins like YGR149W that show differential expression during stress response . Together, these controls form a framework for robust research on uncharacterized proteins, ensuring observed phenomena are specifically attributable to YGR149W function.

How should researchers interpret YGR149W expression data in the context of stress response pathways?

When interpreting YGR149W expression data in stress response contexts, researchers should implement a comprehensive analytical framework. First, contextualize YGR149W's 2.45-fold upregulation within the broader transcriptional landscape by comparing it with established stress response genes; YGR149W shows moderate induction compared to highly induced genes like STL1 (87.68-fold) or HSP12 (47.21-fold) , suggesting a supportive rather than primary role in stress adaptation. Second, perform time-course analyses to determine whether YGR149W represents an early or late responder in the cascade, providing insights into its position in signaling hierarchies. Third, evaluate expression patterns across multiple stress conditions to distinguish between general stress responses and pathway-specific regulation. Fourth, analyze promoter elements using bioinformatic approaches to identify binding sites for stress-responsive transcription factors, particularly those in the Hog1 MAPK pathway. Fifth, utilize genetic approaches by measuring YGR149W expression in strains lacking specific transcription factors or signaling components to establish regulatory dependencies. Sixth, integrate expression data with phenotypic analyses of YGR149W deletion and overexpression strains under matching conditions to correlate expression changes with functional outcomes. Finally, compare expression patterns with protein localization changes during stress, as membrane proteins often show stress-induced redistribution that complements transcriptional regulation. This multi-layered analytical approach will position YGR149W appropriately within stress response networks, distinguishing between correlation and causation in expression datasets.

How can researchers reconcile contradictory findings about YGR149W from different experimental approaches?

When confronting contradictory findings about YGR149W from different experimental approaches, researchers should implement a systematic reconciliation framework. First, carefully evaluate methodological differences, particularly expression systems (E. coli vs. yeast), fusion tags (His, FLAG, MBP) , and growth conditions that might explain discrepancies. Second, consider dosage effects; YGR149W demonstrates differential toxicity between full-length and truncated forms , suggesting concentration-dependent phenomena that might manifest differently across experimental systems. Third, examine strain background variations, as genetic interactions specific to laboratory strains may influence YGR149W function. Fourth, assess temporal factors; apparent contradictions may reflect different time points in dynamic processes, particularly relevant for stress-responsive genes like YGR149W with a 2.45-fold change in expression during stress . Fifth, investigate subcellular localization differences, as membrane proteins may function differently depending on their precise membrane destination. Sixth, consider post-translational modifications that may vary between systems, altering protein function or interactions. Seventh, implement orthogonal validation approaches that can confirm findings through independent methodologies. For particularly significant contradictions, design definitive experiments specifically addressing the discrepancy, ideally combining elements from the contradictory approaches to identify specific variables causing divergent results. Finally, consider biological redundancy or contextual function, where YGR149W may have different roles under different conditions or in different cellular compartments. This systematic approach transforms contradictions into opportunities for deeper mechanistic insights about this uncharacterized membrane protein.

What are the most promising research directions for understanding YGR149W function in cellular stress responses?

The most promising research directions for understanding YGR149W function in cellular stress responses should build on its established 2.45-fold upregulation in the Hog1 MAP kinase pathway and differential toxicity profiles . First, researchers should conduct comprehensive phenotypic profiling of ΔYGR149W strains under precisely controlled osmotic, oxidative, and temperature stress conditions, measuring both acute responses and adaptation kinetics. Second, investigate the membrane dynamics of fluorescently tagged YGR149W during stress, tracking potential relocalization or changes in protein turnover rates. Third, determine the stress-specific interactome of YGR149W using proximity labeling approaches optimized for membrane proteins, comparing interaction networks under normal and stress conditions. Fourth, explore potential roles in membrane remodeling during stress by analyzing lipid composition changes in ΔYGR149W strains and potential direct interactions with membrane lipids. Fifth, investigate functional redundancy by creating combinatorial deletions with other stress-induced membrane proteins, potentially revealing synthetic phenotypes masked by compensatory mechanisms. Sixth, examine translational regulation and post-translational modifications specific to stress conditions, as these may regulate YGR149W activity independently of transcriptional changes. Seventh, develop reconstitution systems to test specific hypotheses about membrane transport or signaling functions in defined environments. These approaches collectively target the intersection of membrane biology and stress signaling, the most likely functional space for YGR149W based on current evidence, and provide complementary perspectives to build a comprehensive understanding of this uncharacterized protein's role in cellular adaptation.

How can high-throughput approaches accelerate functional characterization of YGR149W?

High-throughput approaches can significantly accelerate the functional characterization of YGR149W by systematically exploring its genetic, physical, and phenotypic landscapes. First, implement CRISPR-based screens with a genome-wide sgRNA library in strains overexpressing YGR149W to identify genes that, when disrupted, suppress or enhance its toxicity phenotype , revealing functional pathways. Second, conduct barcode-based chemical genetic screens exposing YGR149W deletion and overexpression strains to diverse compounds, identifying specific chemical sensitivities that suggest functional roles. Third, utilize proteome-wide protein complementation assays optimized for membrane proteins to map YGR149W's comprehensive interaction network. Fourth, perform systematic mutagenesis combined with deep sequencing (deep mutational scanning) to identify critical residues for function and toxicity, particularly valuable given the differential toxicity between full-length and truncated forms . Fifth, implement high-content microscopy screens examining cellular morphology, organelle structure, and membrane properties in strains with modulated YGR149W levels under various stresses. Sixth, apply lipidomic profiling to identify membrane composition changes associated with YGR149W perturbation. Seventh, conduct transposon-sequencing (Tn-seq) under stress conditions in strains with and without YGR149W to identify synthetic genetic interactions specific to stress adaptation pathways. These high-throughput approaches generate massive, multidimensional datasets that can be integrated through computational methods to rapidly converge on testable hypotheses about YGR149W function, dramatically accelerating the characterization process compared to traditional one-experiment-at-a-time approaches.

What potential biotechnological applications might emerge from understanding YGR149W function?

Understanding the function of YGR149W could unlock several promising biotechnological applications, particularly in stress-resistant yeast development and membrane protein engineering. First, if YGR149W proves to be a stress adaptation factor based on its 2.45-fold upregulation during osmotic stress , controlled expression could enhance industrial yeast strain resilience in biofuel production, wine fermentation, and other processes where osmotic fluctuations limit productivity. Second, understanding the molecular basis of YGR149W's differential toxicity between full and truncated forms could provide insights for developing regulatable growth control systems in synthetic biology applications, creating conditional growth switches for biosafety or biocontainment. Third, if functional characterization reveals membrane transport or sensing capabilities, YGR149W could be engineered as a biosensor component for detecting specific environmental conditions or compounds. Fourth, as a membrane protein with potential stress-responsive properties, YGR149W might serve as a scaffold for designing synthetic stress-responsive membrane systems in artificial cells or bioreactors. Fifth, insights into proper expression and folding of this challenging membrane protein could advance protein production technologies for difficult-to-express membrane proteins of pharmaceutical interest. Sixth, understanding YGR149W's role in cellular adaptation could inform strategies for engineering eukaryotic cells with enhanced robustness for various biotechnological applications. These potential applications highlight how fundamental research on uncharacterized proteins like YGR149W can translate into diverse biotechnological innovations, particularly at the intersection of stress biology and membrane protein function.

How can researchers effectively collaborate across disciplines to study YGR149W?

Effective interdisciplinary collaboration for studying YGR149W requires structured approaches that leverage diverse expertise while maintaining cohesive research focus. First, establish a core team combining yeast genetics, membrane protein biochemistry, systems biology, and structural biology specialists, each bringing complementary methodologies to address different aspects of YGR149W function. Second, implement regular structured communication using collaborative platforms containing shared protocols, preliminary data, and literature repositories, with weekly virtual meetings featuring rotating presentations from different disciplinary perspectives. Third, design modular experiments where techniques from different disciplines can be applied to the same biological samples; for example, cells expressing tagged YGR149W variants can be analyzed through biochemical, genetic, and microscopy approaches by different team members. Fourth, develop shared research resources including standardized yeast strains, validated antibodies, and expression constructs that ensure data comparability across disciplines. Fifth, utilize collaborative computational frameworks that integrate diverse experimental data types (expression, interaction, localization, structure) into unified models of YGR149W function. Sixth, implement cross-training through short laboratory exchanges where team members learn techniques from other disciplines to better understand methodological constraints and opportunities. Finally, establish clear publication and authorship guidelines early in the collaboration to avoid later conflicts. This structured collaborative approach transforms disciplinary boundaries from barriers into interfaces where novel insights about YGR149W emerge from the integration of diverse scientific perspectives and methodologies.

What specialized techniques from other fields could be adapted to study YGR149W?

Adapting specialized techniques from diverse fields can provide breakthrough insights into YGR149W function. From neuroscience, optogenetic tools can be modified to control YGR149W activity with light, enabling precise temporal manipulation to study its acute effects on membrane properties and signaling. From materials science, atomic force microscopy techniques optimized for biological membranes can map YGR149W's impact on membrane mechanical properties and nanoscale organization. From synthetic biology, cell-free expression systems incorporating artificial membranes can enable rapid testing of YGR149W variants outside cellular contexts, accelerating functional characterization. From biophysics, single-molecule tracking methodologies can monitor YGR149W dynamics within membranes, revealing potential clustering or partitioning into microdomains during stress responses. From analytical chemistry, native mass spectrometry techniques adapted for membrane proteins can determine oligomeric states and capture transient interactions with lipids or proteins. From medical imaging, super-resolution microscopy approaches can visualize YGR149W's nanoscale distribution and co-localization with other cellular components. From computational biology, molecular dynamics simulations incorporating mixed membrane compositions can predict YGR149W conformational changes in response to membrane perturbations. From plant science, techniques for studying osmotic stress responses in drought-resistant species can provide comparative insights into conserved membrane-based adaptation mechanisms. By thoughtfully adapting these cross-disciplinary techniques, researchers can overcome the traditional challenges of studying uncharacterized membrane proteins like YGR149W, potentially revealing functional aspects inaccessible through conventional yeast biology approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.