Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YIL054W (YIL054W)

What is YIL054W and what are its basic structural characteristics?

YIL054W is an uncharacterized membrane protein found in Saccharomyces cerevisiae (baker's yeast). It consists of 105 amino acids with the following sequence: MAPKAFFVCLPWVLPRHALIVRQAGNPYHFLAYTNPRAPGKLQDSHCPVFFMGIIIITIITVTLAIIIINIIFLTLFDDGMCFYCSLLTFSFVSFNFDHFDHFDL . The protein is encoded by the YIL054W gene and has been assigned the UniProt accession number P40524 .

Structurally, YIL054W appears to contain multiple transmembrane domains, which is consistent with its classification as a membrane protein. The high proportion of hydrophobic amino acids in its sequence suggests integration into cellular membranes. When expressing recombinant versions of this protein for research purposes, it is commonly produced with a histidine tag to facilitate purification .

What is currently known about YIL054W's cellular localization and function?

Despite being categorized as a membrane protein, the precise subcellular localization of YIL054W remains incompletely characterized. Recent research has classified YIL054W as a "Class 2" protein in studies examining the metabolic regulation of misfolded protein import into mitochondria . This classification suggests potential involvement in mitochondrial processes, although direct experimental evidence for mitochondrial localization is still emerging.

What expression systems are most effective for producing recombinant YIL054W?

For researchers seeking to produce recombinant YIL054W, Escherichia coli has proven to be an effective expression system. Commercially available recombinant full-length YIL054W is typically produced in E. coli with a histidine tag to facilitate purification . The expression region encompasses the entire protein sequence (amino acids 1-105) .

When designing expression constructs, it is advisable to include the full sequence of YIL054W to maintain all potential functional domains. The choice of purification tag is important; while His-tags are commonly used for YIL054W purification as evidenced in commercial preparations, researchers should consider the potential impact of tags on protein function when designing experiments. For membrane proteins like YIL054W, expression optimization may require adjustment of induction conditions, temperature, and consideration of specialized strains engineered for membrane protein expression.

To monitor expression and purification efficiency, western blotting using antibodies against YIL054W or the His-tag can be employed. For functional studies, researchers may need to reconstitute the purified protein into appropriate lipid environments to maintain native conformation and activity.

How can researchers design primers for amplifying and cloning the YIL054W gene?

Designing effective primers for YIL054W amplification requires careful consideration of several factors. Based on the genomic sequence of YIL054W, researchers should design forward and reverse primers that include:

• 18-25 nucleotides complementary to the target sequence

• Appropriate restriction enzyme sites for subsequent cloning

• Additional sequences such as Kozak consensus for efficient translation

• Consideration of the His-tag or other fusion tags if required

For optimal PCR amplification of YIL054W, the following conditions are recommended:

• Initial denaturation: 95°C for 5 minutes

• 30-35 cycles of:

  • Denaturation: 95°C for 30 seconds

  • Annealing: 55-60°C for 30 seconds (optimize based on primer design)

  • Extension: 72°C for 30 seconds (1 minute per kb)

• Final extension: 72°C for 10 minutes

When cloning into expression vectors, researchers should consider vectors with strong promoters suitable for the chosen expression system, with appropriate selection markers and fusion tags for purification. Verification of successful cloning should include restriction digestion analysis and DNA sequencing to confirm the correct insertion and sequence integrity of the YIL054W gene.

What are the predicted RNA-binding properties of YIL054W and how can they be experimentally validated?

Computational predictions using the catRAPID algorithm suggest that YIL054W may interact with several RNA molecules, although with relatively modest prediction scores. The highest predicted interaction (prediction score 21.33, z-score 1.01) is with YML009W-B transcript (477 nt) . Other potential RNA interaction partners include NSR1 (prediction score 21.24), NOP1 (prediction score 20.71), and various other transcripts with lower prediction scores .

To experimentally validate these predicted RNA-binding properties, researchers could employ several approaches:

• RNA Immunoprecipitation (RIP) followed by sequencing or qPCR to identify RNAs associated with YIL054W in vivo

• Electrophoretic Mobility Shift Assays (EMSA) using purified recombinant YIL054W and candidate RNA targets

• Cross-linking and Immunoprecipitation (CLIP) methods to identify direct RNA-protein interactions

• Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) to measure binding affinities and kinetics

• Structural studies using NMR or X-ray crystallography to characterize RNA-protein complexes

When designing these experiments, it's important to consider the membrane-associated nature of YIL054W, which may necessitate appropriate detergents or lipid environments to maintain its native conformation during biochemical assays.

What role might YIL054W play in protein misfolding and mitochondrial import pathways?

Recent research has implicated YIL054W in pathways related to protein misfolding and mitochondrial import. YIL054W has been classified as a "Class 2" mutant in studies examining the metabolic regulation of misfolded protein import into mitochondria . Class 2 mutants are characterized by showing no significant increase in split-GFP (spGFP) signal after heat stress compared to normal temperature (30°C) .

This classification provides important insights into YIL054W's potential function. To further investigate its role, researchers could:

• Conduct subcellular fractionation experiments to confirm mitochondrial localization

• Perform co-immunoprecipitation studies to identify protein interaction partners

• Analyze the effects of YIL054W knockout or overexpression on mitochondrial import efficiency

• Study the impact of stress conditions on YIL054W expression and localization

• Employ proteomics approaches to identify changes in the mitochondrial proteome in YIL054W mutants

The absence of spGFP signal increase after heat stress in YIL054W mutants suggests it may play a role in stress response pathways related to protein quality control. This could be further investigated through stress sensitivity assays, analysis of protein aggregation, and measurement of cellular stress markers in YIL054W mutant strains.

What genomic and proteomic approaches are most effective for characterizing uncharacterized proteins like YIL054W?

Characterizing uncharacterized proteins like YIL054W requires integrated genomic and proteomic approaches:

Genomic Approaches:

• Comparative Genomics: Analyzing YIL054W homologs across fungal species can provide evolutionary insights and functional clues.

• Transcriptome Analysis: RNA-seq under various conditions can reveal expression patterns and potential co-regulated genes.

• CRISPR-Cas9 Genome Editing: Creating precise gene knockouts, conditional alleles, or tagged versions of YIL054W for functional studies.

• Synthetic Genetic Array (SGA) Analysis: Systematically creating double mutants to identify genetic interactions.

Proteomic Approaches:

• Mass Spectrometry-Based Proteomics: For identifying post-translational modifications and interaction partners.

• Protein-Protein Interaction Mapping: Using yeast two-hybrid, BioID, or proximity labeling methods.

• Structural Proteomics: Techniques like cryo-EM or X-ray crystallography to determine protein structure.

• Functional Proteomics: Activity-based protein profiling to identify biochemical functions.

For YIL054W specifically, integrating these approaches with specialized techniques for membrane proteins would be particularly valuable. This might include membrane yeast two-hybrid systems, chemical crosslinking mass spectrometry, and lipid-protein interaction studies. The uncharacterized nature of YIL054W makes it an excellent candidate for such comprehensive multi-omics approaches.

How can researchers investigate the potential relationship between YIL054W and splicing mechanisms in yeast?

Given the context of some search results related to splicing strength in yeast genes , researchers might be interested in investigating potential relationships between YIL054W and splicing mechanisms. Although direct evidence linking YIL054W to splicing is limited, several experimental approaches could be employed:

• RNA-Seq Analysis: Compare splicing patterns in wild-type and YIL054W knockout strains to identify potential splicing alterations.

• Splicing Reporter Assays: Utilize fluorescent or luminescent reporters containing introns to measure splicing efficiency in the presence or absence of YIL054W.

• Co-Immunoprecipitation with Splicing Factors: Investigate potential protein-protein interactions between YIL054W and known components of the splicing machinery.

• In Vitro Splicing Assays: Using cell extracts from wild-type and YIL054W mutant strains to assess splicing activity.

• Analysis of Intron-Containing Genes (ICGs): Examine whether YIL054W affects the expression or processing of highly transcribed ICGs, which are particularly dependent on efficient splicing .

The methodology should be especially sensitive to potential membrane-associated or compartment-specific effects on RNA processing, given YIL054W's nature as a membrane protein. Additionally, researchers should consider analyzing splicing under various stress conditions, as YIL054W has been implicated in stress-related protein misfolding pathways .

What experimental approaches can identify the protein interaction network of YIL054W?

Understanding the protein interaction network of YIL054W is crucial for deciphering its function. Several complementary approaches can be employed:

• Affinity Purification-Mass Spectrometry (AP-MS): Using tagged versions of YIL054W to pull down interaction partners, with specialized protocols for membrane proteins that may include crosslinking and detergent optimization.

• Proximity-Dependent Biotin Identification (BioID): Fusing YIL054W to a biotin ligase to identify proteins in its vicinity, particularly useful for transient or weak interactions.

• Split-Ubiquitin Yeast Two-Hybrid: A specialized variant of Y2H designed for membrane proteins that can identify direct protein-protein interactions.

• Co-Immunoprecipitation with Targeted Validation: Using antibodies against YIL054W or tagged versions to pull down complexes, followed by western blotting for suspected interaction partners.

• In Situ Proximity Ligation Assay (PLA): For visualizing protein-protein interactions in their native cellular context.

When designing these experiments, researchers should consider the cellular localization of YIL054W and include appropriate controls. Given its classification in protein misfolding and mitochondrial import pathways , special attention should be paid to potential interactions with chaperones, quality control machinery, and mitochondrial import components. Validation of identified interactions through multiple orthogonal methods is essential for building confidence in the interaction network.

What are the critical considerations when working with recombinant membrane proteins like YIL054W?

Working with membrane proteins presents unique challenges that require specific methodological considerations:

• Solubilization and Stabilization: Membrane proteins like YIL054W require careful selection of detergents or lipid environments to maintain native conformation. Consider testing a panel of detergents (e.g., DDM, LDAO, Triton X-100) at various concentrations to optimize solubilization while preserving function.

• Expression Optimization: Membrane protein overexpression often leads to misfolding or toxicity. Consider using inducible promoters with tight regulation, lower expression temperatures (16-25°C), and specialized expression hosts designed for membrane proteins.

• Purification Strategy: When purifying His-tagged YIL054W , include detergent throughout all purification steps, consider using IMAC followed by size exclusion chromatography, and validate protein integrity using methods like circular dichroism or limited proteolysis.

• Reconstitution Methods: For functional studies, reconstitution into proteoliposomes, nanodiscs, or other membrane mimetics may be necessary to recapitulate the native lipid environment.

• Storage Conditions: Membrane proteins often require specialized storage conditions. For YIL054W, commercial preparations include 50% glycerol in Tris-based buffer , but additional stabilizers or specific detergents may be necessary depending on the intended application.

Researchers should incorporate quality control steps throughout to monitor protein integrity, including SDS-PAGE, western blotting, dynamic light scattering, and when possible, functional assays specific to the protein's activity.

How can researchers effectively use yeast knockout models to study YIL054W function?

YIL054W knockout models provide powerful tools for functional characterization. To effectively utilize these models:

• Selection of Appropriate Knockout Strategy:

  • Complete gene deletion using homologous recombination

  • CRISPR-Cas9 mediated knockout

  • Conditional expression systems (e.g., tetracycline-regulated promoters)

  • Consider both haploid and diploid knockout strains

• Phenotypic Characterization:

  • Growth assays under various conditions (temperature, stress, carbon sources)

  • Microscopy to assess cellular morphology and organelle distribution

  • Flow cytometry for cell cycle analysis and reporter gene expression

  • Metabolic assays relevant to mitochondrial function

• Experimental Design for YIL054W-Specific Study:

  • Based on its classification as a "Class 2" mutant in protein misfolding studies , design experiments focusing on protein quality control

  • Use split-GFP or other reporters to monitor protein mislocalization or aggregation

  • Employ stress conditions like heat shock to test stress response pathways

  • Consider using high-throughput transformation methods as described in the literature: "YKO mutants bearing the above Lsg1 spGFP reporter components were generated by using high-throughput transformation in 96-well plates"

• Controls and Validation:

  • Include appropriate wild-type controls

  • Consider complementation studies by reintroducing YIL054W

  • Validate knockout at both DNA and protein levels

  • Consider examining multiple independent knockout clones

When interpreting results from knockout studies, researchers should be aware of potential compensatory mechanisms and genetic background effects that may influence phenotypes.

How should researchers analyze and interpret RNA-binding prediction data for YIL054W?

The RNA-binding prediction data for YIL054W requires careful analysis and interpretation. The catRAPID algorithm has generated prediction scores for potential RNA interactions , which should be evaluated as follows:

• Understanding Prediction Metrics:

  • Prediction Score: Higher values indicate stronger predicted interactions

  • Z-Score: Indicates statistical significance of the prediction

  • For YIL054W, interactions with prediction scores above 20 and z-scores above 0.9 may warrant experimental validation

• Prioritizing Potential RNA Targets:
  Based on the prediction data, the following RNA targets could be prioritized for experimental validation:

  RNA Target	Prediction Score	Z-Score	RNA Length
  YML009W-B	21.33	1.01	477 nt
  NSR1	21.24	0.99	1245 nt
  NOP1	20.71	0.91	984 nt

• Functional Context Analysis:

  • Consider the biological functions of predicted RNA targets

  • NSR1 and NOP1 are involved in ribosome biogenesis and RNA processing

  • This functional context may provide clues about YIL054W's potential role

• Limitations and Complementary Approaches:

  • Computational predictions have inherent limitations

  • Predictions should be validated using experimental methods

  • Consider integrating with other data types such as transcriptomics and protein localization

When reporting these findings, researchers should clearly indicate that these are computational predictions rather than experimentally validated interactions, using language that accurately reflects the preliminary nature of the data.

What statistical approaches are appropriate for analyzing phenotypic data from YIL054W mutant studies?

When analyzing phenotypic data from YIL054W mutant studies, researchers should employ robust statistical approaches tailored to the experimental design:

• For Growth and Viability Assays:

  • ANOVA with post-hoc tests for comparing multiple conditions

  • Student's t-test (for normally distributed data) or Mann-Whitney U test (for non-parametric data) when comparing two conditions

  • Growth curve analysis using area under the curve (AUC) or doubling time calculations

  • Consider repeated measures designs when appropriate

• For Microscopy and Fluorescence Data:

  • As described in YIL054W research: "Based on mitochondrial spGFP intensity of each mutant and WT cells at two imaging time points, we classified the validated YKO mutants"

  • Quantitative image analysis with appropriate thresholding

  • Mixed-effects models for data with multiple cells per condition

  • Bootstrapping approaches for more robust confidence intervals

• For High-Throughput Screens:

  • Robust Z-score normalization to account for plate effects

  • False discovery rate (FDR) control for multiple hypothesis testing

  • Gene set enrichment analysis (GSEA) for pathway-level interpretations

• Experimental Design Considerations:

  • Include sufficient biological and technical replicates

  • For YIL054W specifically, consider the variance in PWMS (position weight matrix score) between conditions, as similar membrane proteins show "significantly smaller variance in PWMS than the lowly expressed genes"

  • Power analysis to determine appropriate sample sizes

When reporting results, provide both the effect size and statistical significance, and consider visualizing the data using appropriate plots such as box plots, violin plots, or cumulative distribution functions depending on the data type.

What are the most promising future research directions for understanding YIL054W function?

Based on current knowledge and gaps in understanding, several promising research directions emerge:

• Comprehensive Localization Studies:

  • Employing super-resolution microscopy with fluorescently tagged YIL054W

  • Subcellular fractionation combined with western blotting

  • Immunogold electron microscopy for high-resolution localization

  • These approaches would clarify the precise membrane system where YIL054W resides

• Functional Genomics Approaches:

  • Genome-wide synthetic genetic interaction screens with YIL054W

  • Transcriptome analysis of YIL054W knockout strains under various conditions

  • Chemical genetic profiling to identify conditions where YIL054W becomes essential

• Protein Quality Control and Mitochondrial Import:

  • Given its classification as a "Class 2" mutant in protein misfolding studies

  • Detailed analysis of mitochondrial protein import in YIL054W mutants

  • Investigation of interactions with known quality control machinery

  • Assessment of YIL054W role in response to proteotoxic stress

• Structural Biology:

  • Cryo-EM structure determination of YIL054W

  • Computational structure prediction validated by experimental approaches

  • Structure-function relationship studies through targeted mutagenesis

• RNA-Binding Function Validation:

  • Experimental validation of predicted RNA interactions

  • Investigation of potential role in post-transcriptional regulation

  • Assessment of RNA localization in YIL054W mutants

Integration of these approaches would provide a comprehensive understanding of YIL054W's cellular function and potentially reveal new insights into membrane protein biology, mitochondrial quality control, or RNA-protein interactions in yeast.