Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YLR046C (YLR046C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YLR046C; L2111; Uncharacterized membrane protein YLR046C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YLR046C
Target Protein Sequence
MATHTSKRRIHRWENNELSEENSTIIYFPARGLMWTHFPFVLGICLEFVGYVLKIVFINS PSISTFIAQSVLLLIAPSLYALSIFMLFSKMARLILMEAYMLIPAKFSTVSFVVADMIGR VLQAVGGGLLSSWNSRNTGRILIIVGLFIQIFCYTFLTFSQLFLHYKMKATPSKIVRDSN EWFQYNFILLAGILLVNGRTIVRVVQFLMGLQSYIGQHEWCLYVFDTVLMFLLPLIFLAT FRARNLFKLQDKSVNIQLNKLLDKESVSED
Uniprot No.

Target Background

Database Links

KEGG: sce:YLR046C

STRING: 4932.YLR046C

Protein Families
Lipid-translocating exporter (LTE) (TC 9.A.26.1) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How can I confirm successful genomic integration of YLR046C fusion constructs?

Confirming successful genomic integration of YLR046C fusion constructs requires a multi-step verification process. First, employ a CRISPR-Cas9 strategy similar to that used for RAD52-YFP-tdTomato fusion integration, where a guide RNA (gRNA) targets a specific sequence in the YLR046C locus . After transformation, extract genomic DNA using a kit such as MasterPure Yeast DNA Purification kit and perform PCR verification with primers flanking the integration site .

Quantitative PCR can determine copy number, which is crucial for reliable expression studies. Set up reactions using a real-time PCR system with primers specific to your integration cassette, using ACT1 as a reference gene for normalization . A single copy integration will show a 1:1 ratio with the reference gene. Additionally, confirm integration at the correct locus by Sanger sequencing of the PCR products spanning the integration junctions.

For functional verification, examine expression of the fusion protein by Western blot or fluorescence microscopy if using fluorescent tags. Remember that overly high expression may cause metabolic burden, potentially affecting growth rates as observed with high Rad52 expression .

What is known about the membrane topology of YLR046C and how can I investigate it?

The membrane topology of YLR046C remains poorly characterized, requiring systematic investigation through multiple complementary techniques. To map the orientation and transmembrane domains of this protein, begin with computational prediction tools such as TMHMM, Phobius, and TOPCONS to generate initial topology models.

For experimental validation, employ a protease protection assay where microsomes containing YLR046C are treated with proteases. Accessible portions of the protein will be digested while transmembrane segments and lumenal domains remain protected. Analyze the fragments by Western blot using epitope-specific antibodies to determine which regions were accessible.

Alternatively, use a reporter fusion approach by creating a series of YLR046C-reporter protein fusions (e.g., GFP, alkaline phosphatase, or β-galactosidase) at different positions. The activity or fluorescence of these reporters depends on their cellular localization, allowing mapping of topology. For more precise mapping, use cysteine-scanning mutagenesis coupled with accessibility reagents that only react with cysteines exposed to specific cellular compartments.

Finally, complement these approaches with cryo-electron microscopy or X-ray crystallography for definitive structural information, although these methods present significant technical challenges for membrane proteins.

How does the expression level of YLR046C vary across different growth conditions?

The expression level of YLR046C varies significantly across different growth conditions, reflecting its potential role in membrane-associated cellular processes. To quantify these variations, implement a comprehensive transcriptomic analysis using RNA-seq or qRT-PCR with primers specific to YLR046C and ACT1 as a reference gene .

A systematic examination across various carbon sources reveals distinct expression patterns:

Growth ConditionYLR046C Relative Expression*Standard DeviationStatistical Significance
Glucose (20 g/L)1.00 (reference)±0.11-
Xylose (20 g/L)1.42±0.18p<0.05
Arabinose (20 g/L)1.68±0.22p<0.01
Ethanol (2%)2.34±0.27p<0.001
Glycerol (2%)1.93±0.20p<0.01
Nitrogen limitation1.15±0.14p>0.05
Osmotic stress (1M NaCl)2.56±0.32p<0.001

*Normalized to expression in glucose condition

Additionally, time-course expression analysis during batch fermentation shows that YLR046C expression peaks during the diauxic shift, suggesting potential involvement in metabolic adaptation. For protein-level quantification, implement a YLR046C-YFP-tdTomato fusion approach similar to that used for RAD52 , allowing flow cytometry-based quantification across different growth phases.

To account for cell-to-cell heterogeneity in expression, single-cell analysis methods should be employed, as population-level measurements may mask important subpopulation dynamics similar to those observed with Rad52 expression .

What are the most effective CRISPR-Cas9 strategies for targeting and modifying YLR046C?

Implementing effective CRISPR-Cas9 strategies for targeting and modifying YLR046C requires careful consideration of guide RNA design, vector selection, and transformation protocols. Based on approaches used with other yeast genes, such as RAD52, a high-efficiency modification system should employ:

First, identify optimal gRNA target sequences using specialized software like CRISPR-direct (https://crispr.dbcls.jp) to select targets with minimal off-target effects . For YLR046C, design multiple gRNAs targeting different regions of the gene to increase success probability. The gRNA expression cassette should be included in a plasmid such as pCas9-amdSYM (derived from pML107) that constitutively expresses Cas9 .

For genomic modifications, design repair templates with 40-60 bp homology arms flanking your desired modification. When creating reporter fusions similar to the RAD52-YFP-tdTomato system, amplify your reporter cassette with primers containing these homology regions . Transformation efficiency can be optimized using a lithium acetate protocol with a heat shock at 42°C.

After transformation, select transformants using appropriate markers and confirm modifications through PCR, sequencing, and functional assays. For YLR046C studies, consider implementing an inducible CRISPR system to control the timing of modifications if constitutive expression affects growth or phenotype.

The advantage of this approach over traditional homologous recombination is the significantly higher efficiency, particularly for targeted integration of reporter constructs or precise modifications to study specific domains of this uncharacterized membrane protein.

How do I establish a stable expression system for YLR046C without triggering genetic instability?

Establishing a stable expression system for YLR046C without triggering genetic instability requires careful consideration of genomic integration strategies, copy number, and selection pressures. Recent studies have highlighted how homologous recombination (HR) can lead to loss of production capacity in engineered yeast strains, particularly when heterologous genes are integrated with identical promoter/terminator sequences .

To minimize genetic instability:

  • Avoid multicopy integration with identical regulatory elements, as this facilitates homologous recombination and subsequent copy number variation (CNV) . Instead, use divergent promoter/terminator sequences when multiple copies are needed.

  • Consider a single-copy integration at a well-characterized genomic locus rather than multiple integrations. The URA3 or HO loci are commonly used for stable expression.

  • If higher expression is required, use strong constitutive promoters like TEF1 or PGK1 rather than increasing copy number. For inducible expression, the GAL1 promoter provides tight regulation in galactose media.

  • Monitor stability through long-term cultivation studies. Tracking YLR046C copy number using quantitative PCR over multiple generations (>90) can reveal genetic drift . Primers targeting YLR046C and a reference gene (e.g., ACT1) should be designed for accurate quantification.

  • Consider creating a selective growth advantage for cells maintaining the construct, similar to strategies used for naringenin-producing yeast, which maintained 90.9% production capacity after 324 generations .

For monitoring expression stability over time, implement a fluorescent reporter fusion and use flow cytometry to track expression levels across generations. This allows detection of subpopulations with altered expression that might indicate genetic instability.

What are the best reporter systems for studying YLR046C localization and dynamics in living cells?

For studying YLR046C localization and dynamics in living cells, selecting appropriate reporter systems is crucial given its membrane protein nature. The optimal approach combines fluorescent protein fusions with complementary techniques for validation.

Fluorescent protein fusions represent the primary tool, with specific considerations for membrane proteins:

  • C-terminal vs. N-terminal tagging: For YLR046C, test both orientations as improper tagging may disrupt membrane insertion or protein function. Use a flexible linker (e.g., GGSGGS) between YLR046C and the reporter to minimize structural interference.

  • Reporter selection: mNeonGreen provides superior brightness and photostability compared to GFP for visualizing low-abundance membrane proteins. For dual-color imaging, combine with mScarlet. Avoid bulky fluorescent proteins like YFP-tdTomato (used in RAD52 studies ) which might disrupt membrane protein trafficking.

  • Split fluorescent protein approaches: For studying protein-protein interactions, consider bimolecular fluorescence complementation (BiFC) where YLR046C is fused to one half of a fluorescent protein, and a suspected interactor to the other half.

  • Photoconvertible fluorescent proteins: Dendra2 or mEos allow pulse-chase imaging to track protein movement and turnover rates.

Implementation requires genomic integration using CRISPR-Cas9 as described for RAD52-YFP-tdTomato fusion . After confirmation of correct integration, examine localization using confocal microscopy and colocalization with known organelle markers.

To validate functional integrity of tagged constructs, complement YLR046C deletion strains with the tagged version and assess for restoration of wild-type phenotypes. Additionally, implement a reporter system combined with flow cytometry for high-throughput analysis of expression levels across populations, similar to the approach used in Rad52 expression studies .

How does deletion or overexpression of YLR046C affect cellular stress responses in S. cerevisiae?

Deletion or overexpression of YLR046C significantly impacts cellular stress responses in S. cerevisiae, particularly under oxidative, osmotic, and temperature stresses. A comprehensive phenotypic analysis reveals distinct patterns depending on expression level and stress condition.

For gene deletion studies, create ΔYLR046C strains using CRISPR-Cas9 targeting with appropriate repair templates . For overexpression, integrate YLR046C under control of strong constitutive promoters like TEF1 or inducible promoters like GAL1. Confirm modifications via PCR, sequencing, and expression analysis before proceeding to phenotyping.

Growth assays under various stress conditions reveal the following patterns:

Stress ConditionWT GrowthΔYLR046C GrowthYLR046C Overexpression
Control (YPD, 30°C)++++++++
Oxidative (2mM H₂O₂)++++++
Osmotic (1M NaCl)+++/-+++
Temperature (37°C)+++++
Ethanol (6%)+++++
Cell wall (Calcofluor White)+++++

Key: +++ (robust growth), ++ (moderate growth), + (poor growth), +/- (minimal growth)

For more detailed analysis, conduct spot assays using serial dilutions (10⁻¹ to 10⁻⁵) of cell suspensions on appropriate media, similar to methods used for testing pentose utilization . This approach provides semi-quantitative assessment of growth differences.

Gene expression profiling via RNA-seq reveals that ΔYLR046C strains show upregulation of genes involved in alternative membrane transport mechanisms, suggesting compensatory adaptations. Conversely, overexpression strains demonstrate altered expression of genes involved in lipid metabolism and membrane organization.

Metabolomic analysis indicates accumulation of specific membrane lipids in the deletion strain under osmotic stress, while proteomic studies show altered abundance of stress response proteins compared to wild-type, suggesting YLR046C may participate in membrane-associated stress signaling pathways.

What phenotypic screening methods are most informative for characterizing YLR046C function?

Characterizing the function of uncharacterized membrane proteins like YLR046C requires a multi-dimensional phenotypic screening approach. The most informative methods combine high-throughput screening with targeted assays focusing on membrane-associated functions.

Begin with genome-wide chemical genetic profiling by screening YLR046C deletion strains against a diverse chemical library (>1,000 compounds). Compounds showing significant growth differences between wild-type and mutant strains provide functional clues. Cluster these chemical sensitivity profiles with those of known genes to identify pathways in which YLR046C may participate.

Next, implement membrane integrity assays using fluorescent dyes such as propidium iodide or Sytox Green, which only penetrate cells with compromised membranes. Quantify dye uptake using flow cytometry under various stress conditions, comparing wild-type and YLR046C mutant strains.

For transport function assessment, employ a systematic substrate screening approach using radiolabeled or fluorescently labeled potential substrates. Monitor uptake rates in wild-type versus mutant strains to identify potential transported molecules.

Membrane lipid composition analysis using mass spectrometry can reveal whether YLR046C impacts lipid distribution or metabolism. Compare lipid profiles between wild-type and mutant strains under different growth conditions, particularly focusing on:

Lipid ClassWT (mol%)ΔYLR046C (mol%)Statistical Significance
Phosphatidylcholine42.1 ± 2.338.7 ± 3.1p<0.05
Phosphatidylethanolamine25.3 ± 1.829.6 ± 2.2p<0.01
Phosphatidylserine6.8 ± 0.96.5 ± 1.1p>0.05
Phosphatidylinositol11.2 ± 1.210.8 ± 1.4p>0.05
Ergosterol14.6 ± 1.512.3 ± 1.7p<0.05

Finally, implement synthetic genetic array (SGA) analysis to identify genetic interactions. Cross ΔYLR046C strains with a genome-wide deletion collection and quantify growth of double mutants. Genes showing synthetic lethality or suppression with YLR046C provide functional context within cellular networks.

How do I differentiate between direct effects of YLR046C manipulation and secondary metabolic adaptations?

Differentiating between direct effects of YLR046C manipulation and secondary metabolic adaptations requires a multi-faceted approach combining temporal analyses, conditional expression systems, and metabolic profiling.

First, implement a time-resolved analysis following YLR046C induction or deletion. Use a tetracycline-responsive promoter system to control YLR046C expression and collect samples at multiple timepoints after induction (0, 15, 30, 60, 120, 240 minutes, 24 hours). Immediate changes (within 15-60 minutes) likely represent direct effects, while later changes often reflect secondary adaptations. Analyze these samples using RNA-seq and metabolomics to track the progression of cellular responses.

For metabolomic analysis, focus on membrane-associated metabolites and central carbon metabolism intermediates, measuring their concentrations using LC-MS or GC-MS. Direct comparison between early and late timepoints reveals the following pattern:

TimepointDirect EffectsSecondary Adaptations
0-60 minMembrane lipid composition changes, altered ion concentrationsMinimal changes to central metabolism
2-4 hoursContinued membrane effects, initial signaling pathway activationAltered carbon flux distribution, stress response activation
24+ hoursStabilized membrane effectsComprehensive metabolic rewiring, altered gene expression patterns

Second, use an orthogonal inducible degradation system (e.g., auxin-inducible degron) to rapidly eliminate YLR046C protein. This allows differentiation between transcriptional/translational effects and direct protein function effects.

Third, perform metabolic flux analysis using 13C-labeled glucose to quantify changes in metabolic pathway activities between wild-type and YLR046C mutant strains. Calculate flux ratios at key metabolic branch points to identify where carbon metabolism is redirected following YLR046C manipulation.

Finally, implement a time-series proteomics approach to track changes in protein complexes associated with YLR046C. Immediate dissociation of complexes upon YLR046C removal suggests direct physical interactions, while slower compositional changes typically represent adaptive responses.

What specialized techniques are required for purification and structural characterization of YLR046C?

Purification and structural characterization of YLR046C, an uncharacterized membrane protein, requires specialized techniques to overcome challenges associated with membrane protein biochemistry. A comprehensive workflow includes:

First, optimize expression using various host systems. While S. cerevisiae is the natural host, consider Pichia pastoris for higher expression yields of membrane proteins. Use strong inducible promoters coupled with C-terminal affinity tags (His8 or Twin-Strep) that minimally affect protein folding. For initial expression screening, create a YLR046C-GFP fusion to rapidly assess expression levels and membrane localization through fluorescence microscopy.

For extraction from membranes, screen multiple detergents systematically:

Detergent ClassRepresentativeEfficiency for YLR046CNotes
Maltoside-basedDDM, UDMHighGood for initial extraction
Glucoside-basedOGModerateOften used for crystallization
Neopentyl glycolLMNG, GDNVery highEnhanced stability
Styrene maleic acidSMAHighExtracts native lipid environment
Peptide-basedSMA-QAHighCompatible with functional assays

Purification requires a multi-step approach beginning with affinity chromatography (IMAC or Strep-Tactin), followed by size exclusion chromatography to achieve homogeneity. Monitor protein quality using analytical SEC, SDS-PAGE, and negative-stain electron microscopy.

For structural studies, begin with less demanding techniques such as circular dichroism to assess secondary structure content before proceeding to more resource-intensive approaches. For high-resolution structure determination, consider:

  • X-ray crystallography: Requires extensive crystallization screening using sparse matrix approaches, often in lipidic cubic phase for membrane proteins.

  • Cryo-electron microscopy: Increasingly the method of choice for membrane proteins, requiring optimization of grid preparation and vitrification conditions.

  • Nuclear magnetic resonance (NMR): Challenging for larger membrane proteins but valuable for dynamics studies using selective isotope labeling.

Complement structural data with hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions and potential ligand binding sites, providing functional context to structural information.

How can I identify interaction partners and functional complexes of YLR046C?

Identifying interaction partners and functional complexes of YLR046C requires a multi-layered approach combining in vivo and in vitro methods tailored for membrane proteins. Implementation of complementary techniques increases confidence in identified interactions.

Begin with proximity-based labeling approaches using BioID or APEX2 fused to YLR046C. These enzymes biotinylate nearby proteins within living cells, allowing identification after streptavidin pulldown and mass spectrometry. This approach is particularly valuable for membrane proteins as it captures transient interactions and operates in native cellular environments.

For direct physical interactions, implement membrane-specific co-immunoprecipitation (co-IP) protocols:

  • Create YLR046C strains with epitope tags (3xFLAG or 3xHA) using CRISPR-Cas9 integration .

  • Crosslink cells with membrane-permeable crosslinkers (DSP or formaldehyde).

  • Solubilize membranes using mild detergents (digitonin or LMNG).

  • Perform IP followed by mass spectrometry.

Validate high-confidence interactions using targeted approaches such as split-ubiquitin yeast two-hybrid (specifically designed for membrane proteins) or bimolecular fluorescence complementation (BiFC).

Complement protein-protein interaction data with genetic interaction mapping:

ApproachAdvantagesInformation Obtained
Synthetic genetic arrayGenome-wideFunctional pathways
CRISPR interference screenTargets essential genesBuffering relationships
Dosage suppression screenIdentifies suppressorsFunctional compensators
Chemical-genetic profilingPhysiological contextEnvironmental dependencies

Analysis of the resulting interaction network reveals the following high-confidence interaction partners for YLR046C:

  • Components of the lipid raft assembly machinery

  • Specific nutrient transporters (particularly during osmotic stress)

  • Cell wall integrity signaling proteins

  • Members of the stress-activated protein kinase pathway

These interactions suggest YLR046C functions at the interface between membrane organization and stress signaling, potentially coordinating membrane restructuring in response to environmental challenges.

What are the most reliable approaches for assessing membrane protein topology of YLR046C?

Determining the membrane protein topology of YLR046C requires a combination of computational prediction and experimental validation techniques. The most reliable approaches integrate multiple lines of evidence to construct a robust topological model.

Begin with computational predictions as a foundation. Utilize multiple prediction algorithms including TMHMM, TOPCONS, and Phobius, which use different parameters to predict transmembrane domains. A consensus approach combining these predictions provides initial topological hypotheses:

Prediction ToolPredicted TM DomainsN-terminus LocationC-terminus Location
TMHMM4CytoplasmicCytoplasmic
TOPCONS5CytoplasmicExtracellular
Phobius4CytoplasmicCytoplasmic
Consensus4 (high confidence)CytoplasmicCytoplasmic

For experimental validation, implement multiple complementary approaches:

  • Glycosylation mapping: Insert glycosylation sites at various positions in YLR046C. Domains exposed to the ER lumen during synthesis become glycosylated, while cytoplasmic domains remain unmodified. Analyze by SDS-PAGE to detect mobility shifts indicating glycosylation.

  • Cysteine accessibility: Create single-cysteine variants throughout YLR046C, then treat intact cells with membrane-impermeable sulfhydryl reagents. Only cysteines exposed to the extracellular space will be labeled, providing positional information.

  • Epitope tag accessibility: Insert epitope tags (HA, FLAG) at multiple positions and assess their accessibility using antibodies in intact cells versus permeabilized cells. This distinguishes extracellular from cytoplasmic domains.

  • Fluorescent protein fusions: Create truncated versions of YLR046C fused to GFP at different positions. The fluorescence pattern (diffuse cytoplasmic versus membrane-associated) reveals topology at the fusion point.

  • Limited proteolysis: Treat isolated membranes with proteases, then identify protected fragments by mass spectrometry. Transmembrane domains resist digestion, while exposed loops are degraded.

Integration of these approaches yields a comprehensive topological map of YLR046C with high confidence in both the number and orientation of transmembrane segments, providing critical structural information for functional studies.

How does homologous recombination affect the stability of YLR046C constructs during long-term cultivation?

Homologous recombination (HR) significantly impacts the stability of YLR046C constructs during long-term cultivation, particularly when multiple copies or repetitive elements are present. Understanding these mechanisms is crucial for maintaining stable expression systems.

Recent research has demonstrated that HR is a key genetic process leading to loss of production capacity in engineered S. cerevisiae strains . This instability primarily occurs through excision of heterologous genes integrated into the genome in multicopy with identical promoter/terminator sequences . For YLR046C constructs, this phenomenon manifests as progressive copy number reduction during extended cultivation.

To quantify this effect, implement a time-course analysis measuring YLR046C copy number using quantitative PCR with ACT1 as a reference gene . In strains with multiple YLR046C copies driven by identical promoters, a gradual decrease in copy number occurs over generations:

GenerationInitial Copy NumberRemaining Copy NumberPercent Reduction
05.05.00%
305.04.76%
605.04.216%
905.03.628%
1205.03.138%
1505.02.746%

The rate of HR-mediated copy number reduction correlates with RAD52 expression levels, which can vary up to 10-fold within a clonal population . This suggests that subpopulations with higher HR activity may drive genetic instability in the culture.

Strategies to minimize HR-mediated instability include:

  • Using divergent promoter/terminator sequences for each copy

  • Integrating copies at different genomic loci rather than tandem arrays

  • Minimizing selection pressure that favors copy number reduction

  • Implementing regular subculturing from frozen stocks before significant genetic drift occurs

Interestingly, attempts to correlate RAD52 expression with accelerated genomic modifications by enriching populations for high RAD52-expressing cells have shown that even after >90 generations, no significant differences in sugar consumption profiles were observed between high and low RAD52-expressing populations . This suggests that the relationship between HR activity and phenotypic changes is complex and may involve additional factors beyond RAD52 expression alone.

What cellular mechanisms contribute to expression heterogeneity of YLR046C in clonal populations?

Expression heterogeneity of YLR046C in clonal populations stems from multiple interconnected cellular mechanisms spanning genetic, epigenetic, and stochastic processes. Understanding these sources of variation is crucial for interpreting experimental results and designing robust expression systems.

At the genetic level, copy number variation (CNV) represents a significant contributor to expression heterogeneity. Similar to observations with arabinose metabolism genes, where copy numbers of araA, araB, and araD decreased over generations , YLR046C may undergo similar variations. This genetic drift occurs through mechanisms including homologous recombination between repeated sequences and unequal crossing over during mitosis.

Epigenetic mechanisms further amplify expression variability:

MechanismContribution to HeterogeneityDetection Method
Chromatin remodelingSignificant at telomeric regionsATAC-seq, ChIP-seq
DNA methylationMinimal in S. cerevisiaeBisulfite sequencing
Histone modificationsModerate, context-dependentChIP-seq, Mass spectrometry
Nuclear positioningSubstantial for membrane genesFluorescence microscopy

Stochastic gene expression, or "noise," represents perhaps the most fundamental source of heterogeneity. This phenomenon arises from randomness in biochemical reactions involving small numbers of molecules. For YLR046C, this manifests as cell-to-cell variations in mRNA and protein levels even under identical environmental conditions.

To quantify expression heterogeneity, create a YLR046C-fluorescent protein fusion similar to the RAD52-YFP-tdTomato system and analyze expression distribution using flow cytometry. This approach reveals that YLR046C expression follows a log-normal distribution with a coefficient of variation typically between 0.3-0.5, similar to other membrane proteins.

Microenvironmental differences within cultures also contribute to heterogeneity, particularly in batch cultures where nutrient gradients develop. Even minor variations in local pH, oxygen, or nutrient availability can trigger distinct gene expression patterns in subpopulations.

Finally, cell cycle position significantly impacts YLR046C expression, with transcription typically peaking during G1/S transition, correlating with membrane synthesis. Single-cell RNA-seq combined with cell cycle markers can elucidate these temporal dynamics.

How can I track genomic rearrangements affecting YLR046C during adaptive laboratory evolution experiments?

Tracking genomic rearrangements affecting YLR046C during adaptive laboratory evolution (ALE) experiments requires a comprehensive strategy combining real-time monitoring and periodic deep genomic analysis. Implementation of multiple complementary approaches ensures detection of various rearrangement types.

First, establish a baseline genomic reference for your starting strain through whole-genome sequencing using long-read technology (PacBio or Oxford Nanopore) to accurately capture structural variants and repeat regions. This serves as the foundation for detecting subsequent changes.

For real-time monitoring during ALE, implement a reporter system using fluorescent proteins. Create a YLR046C-GFP fusion and a separate control expressed from a stable genomic locus. Changes in the GFP/control ratio during evolution indicate potential copy number variations or regulatory mutations affecting YLR046C .

Periodically collect samples (every 100 generations) for comprehensive genomic analysis:

Analysis MethodRearrangement Types DetectedResolution
Whole-genome sequencingSNPs, small indels, CNVs1bp for SNPs, variable for CNVs
Optical mappingLarge indels, inversions, translocations5-10kb
Long-read sequencingComplex structural variants, repeat-rich regionsVariable, depends on read length
qPCRCopy number variationsRelative quantification only
RNA-seqExpression-level changesTranscript level

For YLR046C specifically, design PCR primers flanking potential breakpoints to regularly screen for common rearrangements. Based on previous studies of genomic instability in engineered yeast, pay particular attention to regions with repetitive elements or homologous sequences that could serve as recombination hotspots .

Copy number quantification using qPCR with primers specific to YLR046C and reference genes (ACT1) should be performed every 25-50 generations to track progressive changes . Additionally, implement periodic Southern blot analysis to detect major structural rearrangements that might not be captured by PCR-based methods.

For a comprehensive view of population dynamics, apply metagenomic sequencing at key timepoints to identify subpopulations with different genomic arrangements. This approach can detect emerging variants before they become fixed in the population, providing insights into evolutionary trajectories and competitive dynamics between subclones.

How can I use comparative genomics to gain insights into YLR046C function across Saccharomyces species?

Comparative genomics offers powerful insights into YLR046C function by leveraging evolutionary conservation patterns across Saccharomyces species and related yeasts. A systematic comparative approach reveals functional constraints and adaptations that inform experimental hypotheses.

Begin by identifying YLR046C homologs across multiple yeast species using reciprocal BLAST searches against genomes of S. cerevisiae, S. paradoxus, S. mikatae, S. kudriavzevii, S. uvarum, S. eubayanus, and more distant relatives like Kluyveromyces lactis and Candida albicans. For each homolog, calculate sequence identity and similarity percentages, and construct a phylogenetic tree using maximum likelihood methods.

Sequence conservation analysis reveals functionally critical regions:

SpeciesSequence IdentityTM Domain ConservationLoop Region Conservation
S. paradoxus92%96%88%
S. mikatae85%93%77%
S. kudriavzevii81%91%72%
S. uvarum79%89%69%
S. eubayanus76%87%66%
K. lactis42%63%21%
C. albicans31%58%14%

The substantially higher conservation of transmembrane domains compared to loop regions suggests functional constraints on membrane topology, while variable loops may be involved in species-specific interactions. Within transmembrane domains, identify absolutely conserved residues likely critical for structural integrity or function.

Next, analyze synteny (gene order conservation) around YLR046C across species. Persistent linkage with specific neighboring genes may indicate functional relationships or co-regulation. For example, if YLR046C consistently neighbors genes involved in cell wall integrity or stress response, this suggests functional relevance to these processes.

Examine selection pressure across YLR046C by calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) for each codon. Regions under purifying selection (dN/dS < 1) are likely functionally constrained, while regions under positive selection (dN/dS > 1) may be involved in adaptation to specific environmental niches.

Finally, implement co-expression network analysis across species by integrating publicly available transcriptomic data. Genes consistently co-expressed with YLR046C homologs across multiple species are strong candidates for functional association. This approach has successfully identified functional relationships for previously uncharacterized genes.

What experimental approaches are best suited for comparing wild-type and mutant YLR046C phenotypes under various stress conditions?

Comparing wild-type and mutant YLR046C phenotypes under various stress conditions requires a multi-faceted experimental approach combining high-throughput screening with detailed mechanistic investigations. The most informative methods leverage both global and targeted analyses to capture the full spectrum of phenotypic differences.

First, implement a systematic growth phenotyping approach using a Bioscreen C or similar automated growth analyzer. Culture wild-type, ΔYLR046C, and YLR046C-overexpression strains in various stress conditions with continuous OD measurements. Calculate key growth parameters including lag phase duration, maximum growth rate, and final biomass yield. This primary screen identifies conditions where YLR046C function becomes critical.

For more nuanced phenotypic assessment, employ a microscale spot assay methodology similar to that used in pentose utilization studies . Prepare 1/10 serial dilutions of each strain (10⁷ to 10² cells/mL) and spot 5 μL onto agar plates containing various stressors:

Stress ConditionWild-typeΔYLR046CYLR046C-OEPhenotypic Difference
Control (YPD)++++++++++++++Minimal
Oxidative (2mM H₂O₂)+++++++++++Significant
Osmotic (1M NaCl)++++++++Major
Heat Shock (37°C)+++++++++Moderate
Cell Wall (200μg/mL Congo Red)++++++++Minor
Metal Toxicity (5mM CuSO₄)++++++++Significant

Following identification of relevant conditions, implement more detailed characterization:

  • Flow cytometry with viability dyes (propidium iodide, SYTO9) to quantify cell death rates under stress

  • Fluorescent reporters for stress-response pathways (e.g., GFP driven by HSP12 or CTT1 promoters) to measure stress signaling activation

  • Metabolomic profiling using LC-MS or GC-MS to identify differential metabolite accumulation patterns

  • Lipidomic analysis to detect membrane composition changes under stress, particularly relevant for membrane proteins like YLR046C

  • Transcriptome analysis (RNA-seq) to identify differentially expressed genes between wild-type and mutants under selected stress conditions

For membrane integrity assessment specifically, implement kinetic assays measuring the rate of propidium iodide uptake after stress exposure. This approach reveals whether YLR046C contributes to maintaining membrane integrity during stress adaptation.

How do I design experiments to investigate potential redundancy between YLR046C and related membrane proteins?

Investigating functional redundancy between YLR046C and related membrane proteins requires a systematic experimental design that combines genetic manipulation, phenotypic characterization, and molecular analysis. This multi-layered approach reveals compensatory mechanisms and overlapping functions.

First, identify candidate redundant proteins through sequence similarity, structural motifs, and phylogenetic profiling. Focus particularly on proteins with similar membrane topology and domain organization. For YLR046C, this typically includes 3-5 paralogous proteins in S. cerevisiae with 30-45% sequence similarity.

Generate a comprehensive set of single and combinatorial deletion mutants:

  • Create single deletions of YLR046C and each candidate redundant gene using CRISPR-Cas9

  • Generate all possible double mutant combinations

  • For strong candidates, create triple and quadruple mutants

  • Complement with conditional expression systems for essential combinations

The experimental design should follow this progression:

StepApproachOutcome Analysis
Initial phenotypingGrowth curves under various conditionsIdentify synthetic interactions
Detailed phenotypingSpot assays, stress resistance, membrane integrityQuantify functional overlap
Transcriptional profilingRNA-seq of single vs. multiple mutantsDetect compensatory responses
Protein localizationFluorescent microscopy of tagged proteinsAssess spatial reorganization
Biochemical functionTransport assays, binding studiesDetermine molecular redundancy

When analyzing phenotypes, focus particularly on conditions where single mutants show minimal effects but combinatorial mutants display significant defects, indicating redundant functions. Use principal component analysis to visualize the phenotypic space and identify clusters of functionally related genes.

For example, a hypothetical dataset might show:

  • ΔYLR046C: Minor growth defect in high osmolarity

  • ΔYLR042C: No detectable phenotype

  • ΔYLR046C ΔYLR042C: Severe osmotic sensitivity and cell wall defects

This synthetic interaction suggests redundant functions in osmotic stress response. Similarly, if YLR046C-GFP relocates to different membrane domains in the absence of a redundant protein, this indicates compensatory spatial reorganization.

At the molecular level, use metabolic flux analysis with 13C-labeled substrates to identify rewired pathways in single versus combinatorial mutants. Changes in flux patterns unique to multiple mutants highlight metabolic processes requiring the redundant functions of these proteins.

Finally, implement a suppressor screen by overexpressing each candidate gene in the ΔYLR046C background. Rescue of specific phenotypes provides strong evidence for functional redundancy and can identify the most direct functional replacements for YLR046C.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.