Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YOL107W (YOL107W)

Shipped with Ice Packs
In Stock

Description

Protein Overview

YOL107W is classified as a putative integral membrane protein in S. cerevisiae with no confirmed enzymatic or structural role. Key features include:

  • Localization: GFP-fusion proteins localize to the cytoplasm and colocalize with early Golgi/COPI vesicles in punctate patterns .

  • Essentiality: Non-essential for viability under standard laboratory conditions .

  • Post-translational modifications: No reported glycosylation or phosphorylation sites.

Genetic and Physical Interactions

YOL107W participates in genetic networks with proteins involved in metabolism and signaling:

InteractorInteraction TypeSGA ScoreFunctional AssociationCitation
YHR045WNegative Genetic-0.159Iron/carbohydrate metabolism
GPR1Positive Genetic+0.325G-protein-coupled glucose sensing
GLO3PhysicalN/ACOPI vesicle trafficking

Key insights:

  • The negative interaction with YHR045W suggests compensatory roles in metabolic homeostasis .

  • Positive interaction with GPR1 implies potential involvement in nutrient-sensing pathways .

Metabolic Impact of Deletion

Deletion of YOL107W (yol107wΔ) alters amino acid homeostasis, as shown by metabolic profiling:

  • Amino acid perturbations: Elevated cysteine and glutamine levels compared to wild-type strains .

  • Mahalanobis distance: 3.2 (indicating moderate metabolic disruption) .

  • Functional clustering: Groups with genes involved in vacuolar protein sorting (e.g., VPS28, VPS36) .

Localization and Trafficking

YOL107W’s punctate cytoplasmic localization overlaps with COPI vesicles, which mediate retrograde Golgi-to-ER transport . This pattern resembles:

  • Glo3p: A COPI vesicle coat component .

  • Yeb3p/Vac8p: Armadillo-repeat proteins involved in vacuolar fusion .

Research Challenges and Gaps

  • Expression: No detectable expression data under standard growth conditions .

  • Functional annotation: Lacks GO biological process or molecular function terms .

  • Structural data: No crystallography or NMR studies available .

Experimental Reagents and Databases

  • TRIPLES database: Contains transposon-insertion alleles for YOL107W but reports no phenotypes .

  • BioGRID: Documents 3 high-throughput genetic interactions .

Hypothetical Roles

Based on interaction and localization data, YOL107W may:

  1. Facilitate COPI vesicle docking via unidentified binding partners.

  2. Modulate metabolic flux in response to nutrient availability via GPR1 crosstalk.

  3. Stabilize membrane contact sites between Golgi and cytoplasmic compartments.

Future Directions

  • CRISPR-based tagging: To study dynamic localization under stress.

  • Proteomic pulldowns: Identify binding partners in COPI vesicle pathways.

  • Lipidomics: Assess membrane composition changes in yol107wΔ strains.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
YOL107W; Transmembrane protein 115 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YOL107W
Target Protein Sequence
MQYSSRFLELNIPDSFLNINKIPDATKFITVTYICLTATLFCIRRSLYNKLVLEDPNLDY NLITSPLLQMVPSQIWRYPTSLVLSNFIDTKAWKVVVNLLNLIIGGSFIERNWNSSKEMF KFIIVLGSLTNVLIIMLTLLVSFFSNKVRLDIPLDGNYTILIGFPIIYRQLLPETTIIHL KTPQFLAKNFRFKLLPIFVMFTMTVTQIIWFHHFAQLFSIWVTFFASWSYLRFFQKLAPL NCPSLPTTNSQGGQEILVGDASDTFQLIYFFPDLIKPILRPIFNFIYNVVVVKFKVIKPF HDIDIDIGNTIAESRGAKKIMTVEERRRQLALQVLEERMVNP
Uniprot No.

Target Background

Function
This protein may play a role in the retrograde transport of proteins from the Golgi to the endoplasmic reticulum.
Database Links

KEGG: sce:YOL107W

Protein Families
TMEM115 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is YOL107W and why is it significant for research?

YOL107W is an uncharacterized membrane protein in Saccharomyces cerevisiae (baker's yeast) identified in the reference genome sequence derived from laboratory strain S288C . Its significance lies in understanding membrane protein function and regulation in eukaryotic cells. As an uncharacterized protein, research on YOL107W contributes to filling knowledge gaps in the yeast proteome and potentially revealing novel cellular mechanisms in membrane biology.

What expression systems are recommended for recombinant production of YOL107W?

For optimal expression of YOL107W, modified strains of S. cerevisiae lacking competing endogenous membrane proteins are recommended. Based on analogous approaches with E. coli membrane proteins, deletion mutants lacking major membrane proteins show improved expression of recombinant membrane proteins . While evidence from E. coli systems demonstrates that strains lacking outer membrane proteins (OMPs) like OmpA, OmpC, OmpF, and LamB show significantly higher production of test membrane proteins , a similar approach can be adapted for S. cerevisiae by creating deletion mutants of abundant yeast membrane proteins that might compete with YOL107W for membrane insertion machinery.

How can I verify successful expression of recombinant YOL107W?

Verification of YOL107W expression can be performed using multiple complementary techniques:

  • Western blotting: Using epitope tags (HA or StrepII) fused to YOL107W allows detection via antibodies in whole cell lysates. Quantification can be performed by comparing band intensities across different expression systems .

  • Whole-cell ELISA: This provides quantitative assessment of surface-exposed proteins, confirming both expression and proper membrane insertion. This technique has been demonstrated for membrane proteins with minimal variability between biological replicates .

  • SDS-PAGE analysis: Preparation of membrane fractions followed by silver or Coomassie staining can visualize overexpressed membrane proteins .

  • Mass spectrometry: For label-free identification and confirmation of the expressed protein sequence.

How can I design primers for amplifying and modifying the YOL107W locus?

Primer design for YOL107W amplification should follow these methodological guidelines:

  • Obtain the sequence information from the Saccharomyces Genome Database (SGD) .

  • Design primers with appropriate restriction sites for cloning into expression vectors.

  • For knockout construction, design primers that amplify 500-1000 bp up- and downstream of the YOL107W coding sequence.

  • For epitope tagging, ensure the tag is in-frame with the coding sequence and preferably positioned at a terminus less likely to interfere with function.

  • Verify specificity using BLASTN against the S. cerevisiae genome .

Optimal PCR conditions include: initial denaturation at 98°C for 30 seconds, followed by 30 cycles of 98°C for 10 seconds, 55-60°C for 30 seconds, and 72°C for 30 seconds per kb of target, with a final extension at 72°C for 5 minutes.

What approaches are effective for creating YOL107W deletion mutants?

Creating YOL107W deletion mutants can be accomplished through several methods:

  • PCR-based gene deletion: Using primers with 40-50 bp homology to regions flanking YOL107W and a selectable marker (e.g., KanMX). This approach has been successfully used to create knockout strains of membrane proteins in E. coli .

  • CRISPR-Cas9: Design guide RNAs targeting YOL107W and provide a repair template with homology arms to create a clean deletion.

  • Verification: Confirm deletions by PCR across the junction points and by analyzing membrane protein profiles using SDS-PAGE, as demonstrated for E. coli membrane protein knockouts .

What bioinformatic tools are most valuable for predicting YOL107W function?

Several bioinformatic approaches can help predict the potential functions of YOL107W:

  • Sequence homology: BLASTP against fungal genomes can identify conserved domains and homologs with known functions .

  • Protein structure prediction: Tools like AlphaFold can predict the 3D structure of YOL107W, providing insights into potential binding sites or functional domains.

  • Gene Ontology analysis: Examining GO annotations in SGD can suggest potential biological processes, molecular functions, and cellular components associated with YOL107W .

  • Protein-protein interaction prediction: Integrating interaction data from experimental sources can suggest functional pathways involving YOL107W.

  • Transmembrane topology prediction: Tools like TMHMM can predict membrane-spanning regions, which is crucial for understanding membrane protein orientation and function.

How can I assess the subcellular localization of YOL107W?

Determining the precise subcellular localization of YOL107W is critical for functional studies. Methodological approaches include:

  • Fluorescent protein tagging: Fusion of GFP or other fluorescent proteins to YOL107W, followed by live-cell imaging.

  • Immunofluorescence microscopy: Using antibodies against epitope-tagged YOL107W.

  • Subcellular fractionation: Isolating different cellular compartments (plasma membrane, endoplasmic reticulum, Golgi, etc.) followed by Western blotting.

  • Protease protection assays: To determine the orientation of YOL107W in the membrane and identify which domains are exposed to different cellular compartments.

What are the best approaches for identifying interaction partners of YOL107W?

Identifying protein interaction partners is crucial for understanding YOL107W function. Effective methodologies include:

  • Affinity purification coupled with mass spectrometry (AP-MS): Using epitope-tagged YOL107W as bait to pull down interacting proteins.

  • Yeast two-hybrid screening: Modified for membrane proteins using split-ubiquitin or MYTH (Membrane Yeast Two-Hybrid) systems.

  • Proximity labeling: Using BioID or APEX2 fused to YOL107W to identify proteins in its proximity.

  • Co-immunoprecipitation: With antibodies against tagged YOL107W to identify stable interacting partners.

  • Crosslinking coupled with mass spectrometry: To capture transient interactions.

How can synthetic genetic array (SGA) analysis be applied to study YOL107W function?

SGA analysis provides a powerful approach to systematically explore genetic interactions of YOL107W:

  • Cross a YOL107W deletion strain with an array of deletion mutants covering the yeast genome.

  • Select for double mutants and quantify growth phenotypes to identify synthetic lethal or synthetic sick interactions.

  • Apply computational analysis to place YOL107W in functional networks based on its genetic interaction profile.

  • For membrane proteins like YOL107W, special attention should be paid to interactions with genes involved in membrane trafficking, lipid metabolism, and cell wall biosynthesis.

  • Consider using temperature-sensitive alleles or conditional expression systems if YOL107W deletion proves lethal.

What considerations are important when designing experiments to study YOL107W in synthetic recombinant populations?

When studying YOL107W in synthetic recombinant populations, several methodological considerations are crucial:

  • Crossing design: Pairwise crossing of isogenic strains maintains more genetic variation than simple mixing of strains in equal proportion . This is particularly important for evolution experiments where adaptation is primarily fueled by standing genetic variation.

  • Parental strain selection: The number and genetic diversity of parental strains impacts the genetic variation in the resulting population .

  • Allele tracking: Develop methods to track the YOL107W allele frequency in evolving populations, such as allele-specific PCR or deep sequencing.

  • Phenotypic assays: Design assays relevant to membrane protein function, such as stress resistance, membrane integrity, or transport activity.

  • Control populations: Include control populations with known membrane protein variants to benchmark the behavior of YOL107W variants.

How can I address challenges in purifying YOL107W for structural studies?

Purification of membrane proteins for structural studies presents significant challenges. Methodological approaches include:

  • Detergent screening: Systematically test various detergents (DDM, LDAO, OG, etc.) for their ability to solubilize YOL107W while maintaining its native conformation.

  • Fusion protein strategies: Create fusions with well-folding proteins like GFP or MBP to improve solubility and provide a purification handle.

  • Nanodiscs or amphipols: Reconstitute purified YOL107W into these membrane mimetics for increased stability.

  • Limited proteolysis: Identify stable domains that might be more amenable to structural studies.

  • Expression optimization: Test different promoters, induction conditions, and growth temperatures to maximize correctly folded protein production.

What safety considerations apply to working with recombinant S. cerevisiae expressing YOL107W?

Saccharomyces cerevisiae has an extensive history of safe use in research and industry. The Environmental Protection Agency (EPA) has conducted a risk assessment of S. cerevisiae and determined it to be generally safe . The organism is considered non-pathogenic to humans and animals in immunocompetent individuals . The National Institutes of Health Guidelines for Research Involving Recombinant DNA Molecules considers S. cerevisiae a safe organism, and most experiments involving it have been exempted from the NIH Guidelines based on safety analysis .

When working specifically with YOL107W-expressing strains, standard laboratory safety practices for handling microorganisms are sufficient. S. cerevisiae does not carry virulence factors to humans or animals, though it does carry certain plasmids that can transfer between Saccharomyces species . Therefore, proper containment procedures should be followed to prevent unintended release of recombinant strains.

What strain containment methods are recommended for experiments with modified YOL107W?

Even though S. cerevisiae is considered safe, implementing proper containment methods for recombinant strains is good laboratory practice:

  • Use auxotrophic markers to ensure the strain cannot survive outside laboratory conditions.

  • Implement biological containment by using strains with conditional essential genes.

  • Follow institutional biosafety committee guidelines for handling recombinant organisms.

  • Autoclave all materials that have come in contact with the recombinant strains before disposal.

  • Maintain detailed records of strain construction and experimental procedures for regulatory compliance.

How can I address poor expression of recombinant YOL107W?

Poor expression of membrane proteins is a common challenge. Methodological solutions include:

  • Strain optimization: Use deletion mutants lacking abundant membrane proteins that might compete for the membrane insertion machinery, similar to the approach demonstrated for E. coli membrane proteins .

  • Codon optimization: Adapt the coding sequence to the preferred codon usage of S. cerevisiae.

  • Induction conditions: Test different temperatures, induction times, and inducer concentrations to optimize expression conditions.

  • Fusion tags: Try different fusion partners or tags that might improve folding and stability.

  • Growth media optimization: Adjust media composition, particularly carbon sources and osmolarity, which can affect membrane protein expression.

What approaches can resolve difficulties in detecting YOL107W in membrane fractions?

If YOL107W is difficult to detect in membrane fractions, consider these methodological solutions:

  • Enrichment techniques: Optimize membrane isolation protocols with differential centrifugation or density gradient separation.

  • Alternative tags: Test different epitope tags (HA, FLAG, StrepII) as some may be more accessible for detection in the context of membrane proteins .

  • Improved solubilization: Screen different detergents and solubilization conditions to efficiently extract YOL107W from membranes.

  • Western blot optimization: Adjust transfer conditions for high molecular weight or hydrophobic proteins.

  • Sample preparation: Test different heating times and temperatures for SDS-PAGE sample preparation, as membrane proteins can aggregate when boiled.

How can I troubleshoot inconsistent phenotypes in YOL107W mutant strains?

Inconsistent phenotypes in membrane protein mutants can be addressed through several approaches:

  • Genetic background verification: Confirm the genetic background of your strains, as suppressor mutations might arise during strain construction.

  • Growth condition standardization: Strictly control growth conditions, as membrane protein phenotypes are often sensitive to environmental factors.

  • Single colony isolation: Work with freshly isolated single colonies to prevent population heterogeneity.

  • Complementation testing: Reintroduce wild-type YOL107W to verify that observed phenotypes are specifically due to YOL107W mutation.

  • Control experiments: Include positive and negative controls in each experiment to benchmark phenotypic assessments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.