Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YPR071W (YPR071W)

What is YPR071W and what do we currently know about its structure?

YPR071W is an uncharacterized membrane protein in Saccharomyces cerevisiae (baker's yeast) consisting of 211 amino acids. According to available data, it has the UniProt accession number Q12346 and alternative ORF name YP9499.26. The protein contains a membrane-spanning domain and has a predicted molecular weight consistent with its amino acid sequence. The full amino acid sequence begins with MQNGTEDKSNIPARSNDDVLPPLAVRLTMKVMRLIFIGKMFAYSF and continues through to its C-terminal end . Structural prediction models suggest it likely contains multiple transmembrane domains, though high-resolution structural data remains unavailable.

What expression systems are most effective for studying YPR071W?

For studying YPR071W, homologous expression in S. cerevisiae is typically the preferred approach as it provides the native cellular environment. The expression can be achieved using vectors with appropriate promoters (constitutive like PGAP or inducible like PGAL) and selection markers. For heterologous expression, similar approaches used for other yeast membrane proteins can be employed, including:

• Episomal plasmids with selection markers for stable maintenance

• Integration vectors for genomic insertion

• Expression cassettes with epitope tags for detection and purification

When constructing recombinant S. cerevisiae strains, techniques similar to those used for other membrane proteins can be applied, including PCR amplification of the target gene and ligation into expression vectors with appropriate restriction sites, similar to methods used for other yeast proteins .

How can successful expression of recombinant YPR071W be verified?

Verification of successful YPR071W expression can be accomplished through several complementary methods:

• Western blot analysis using antibodies against epitope tags (such as His-tag) fused to YPR071W

• Mass spectrometry identification of the expressed protein

• Fluorescence microscopy of GFP-tagged YPR071W to confirm expression and localization

• RT-PCR or qPCR to verify transcription of the gene

For tagged versions of the protein, western blot coupled with anti-His tag or other epitope-specific antibodies can confirm expression, similar to verification methods used for other recombinant yeast proteins .

What genetic approaches can help determine YPR071W function?

Several genetic approaches can help elucidate YPR071W function:

• Deletion mutant phenotypic analysis: Creating ypr071w∆ strains and assessing growth rates, stress responses, and other phenotypes under various conditions

• Genetic interaction screens: Systematic deletion of YPR071W in combination with other gene deletions to identify genetic interactions

• Suppressor screens: Identification of mutations that suppress phenotypes associated with YPR071W deletion

• Overexpression studies: Examining phenotypic consequences of YPR071W overexpression

Similar approaches have been successfully used to characterize other previously uncharacterized yeast genes, such as YIL039W (later named TED1), which was found to function in trafficking pathways .

How can protein-protein interaction studies inform YPR071W function?

Protein-protein interaction studies are crucial for understanding YPR071W's functional context:

• Affinity purification coupled with mass spectrometry (AP-MS): Using tagged YPR071W as bait to identify interaction partners

• Yeast two-hybrid screening: Identifying direct protein interactions

• Proximity-dependent biotin identification (BioID): Detecting proteins in close proximity to YPR071W

• Co-immunoprecipitation: Validating specific protein-protein interactions

Analysis of such data can place YPR071W in a functional network, similar to how genetic interaction mapping positioned TED1 (YIL039W) within a functional pathway with Emp24p and Erv25p .

What methods are recommended for determining YPR071W subcellular localization?

Determining subcellular localization is essential for understanding membrane protein function:

• Fluorescence microscopy of GFP-tagged YPR071W

• Immunofluorescence using antibodies against epitope-tagged YPR071W

• Subcellular fractionation followed by western blotting

• Density gradient centrifugation to separate cellular compartments

As demonstrated with other yeast membrane proteins, localization patterns can provide important functional insights. For example, ER localization might suggest roles in protein folding or early secretory pathway functions .

How can the membrane topology of YPR071W be experimentally determined?

Membrane topology determination requires specialized approaches:

• Protease protection assays: Determine which domains are accessible to proteases

• Glycosylation mapping: Identify luminal domains using N-glycosylation site insertion

• Cysteine accessibility methods: Use membrane-permeable and impermeable sulfhydryl reagents

• Fluorescence protease protection (FPP) assay: Determine the orientation of protein domains

These methods help create a topological map showing how YPR071W spans the membrane, identifying cytosolic, transmembrane, and luminal domains.

What considerations are important when designing site-directed mutagenesis experiments for YPR071W?

Site-directed mutagenesis requires careful planning:

• Identify conserved residues through sequence alignment with homologs

• Target predicted functional domains or motifs

• Consider the following mutation types:

  • Conservative substitutions to test specific chemical properties

  • Alanine scanning of specific regions

  • Domain deletions or swaps to test functional regions

• Include appropriate controls (wild-type, known non-functional mutants)

• Use quantitative phenotypic assays to measure effects

Mutational analysis should focus on potentially functional motifs identified in the YPR071W sequence, similar to structure-function studies that identified amino acid motifs in Kir channels .

How can transcriptomics and proteomics approaches enhance our understanding of YPR071W?

Multi-omics approaches provide comprehensive insights:

Integration of these datasets can reveal functional pathways and processes in which YPR071W participates.

What growth conditions should be tested when characterizing YPR071W deletion strains?

Comprehensive phenotypic profiling should include:

• Growth rate determination under various conditions:

  • Different carbon sources (glucose, galactose, glycerol)

  • Osmotic stress (high salt, sorbitol)

  • pH variations

  • Temperature sensitivity

  • Presence of drugs or toxins

• Cell morphology and cell cycle progression analysis

• Stress response pathway activation

• Membrane integrity assays

Growth assays similar to those used in identifying TED1 function can be applied, such as testing growth in high Na⁺ media or sensitivity to hygromycin B .

How can genetic interaction mapping be used to position YPR071W in functional networks?

Genetic interaction mapping strategies include:

• Systematic construction of double mutants (ypr071w∆ combined with other deletions)

• Quantitative measurement of genetic interactions (negative/positive, synthetic lethality)

• Epistasis mini-array profiling (E-MAP) to generate interaction profiles

• Clustering analysis to identify functionally related genes

Similar approaches have successfully positioned uncharacterized genes in functional pathways, as demonstrated by the identification of TED1's relationship with Emp24p and Erv25p through E-MAP analysis and validation through complementary approaches .

What purification strategies work best for membrane proteins like YPR071W?

Membrane protein purification requires specialized protocols:

• Selection of appropriate detergents for solubilization (DDM, LMNG, etc.)

• Affinity chromatography using tags (His, FLAG, etc.)

• Size exclusion chromatography for further purification

• Assessment of protein stability and homogeneity

• Reconstitution into lipid nanodiscs or liposomes for functional studies

Protein storage considerations include buffer optimization (typically Tris-based with 50% glycerol) and temperature (-20°C for short-term, -80°C for extended storage) .

What structural biology techniques are most appropriate for YPR071W characterization?

Several structural biology approaches can be applied:

• X-ray crystallography (challenging but high resolution)

• Cryo-electron microscopy (increasingly powerful for membrane proteins)

• NMR spectroscopy (for specific domains or fragments)

• Small-angle X-ray scattering (SAXS) for low-resolution envelope

• Hydrogen-deuterium exchange mass spectrometry for dynamics

• Computational structural prediction using AlphaFold2 or RoseTTAFold

Each method has strengths and limitations for membrane protein analysis, and a combination approach is often most informative.