Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial carrier SCRG_05595 (SCRG_05595)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCRG_05595; Uncharacterized mitochondrial carrier SCRG_05595
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Target Names
SCRG_05595
Target Protein Sequence
MANQNSDLYKQITAGSVAAVFQTTMTYPFEYLKTGLQLQPKGTAFEIILPQIKSYFVGCS ALNVAAFGKTILRFVTFDKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPF ENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHNVATKSTPVARIEKLLPAVKHMYETRGP AAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSVITGLATSFTLVAMTQPID VVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVS LLLGFSSRS
Uniprot No.

Target Background

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the predicted structural characteristics of the uncharacterized mitochondrial carrier SCRG_05595?

While SCRG_05595 remains uncharacterized, mitochondrial carrier proteins in S. cerevisiae typically share common structural features with other members of the mitochondrial carrier family (MCF). These proteins generally contain six transmembrane domains arranged in three repeats of approximately 100 amino acids each, with both N and C termini facing the intermembrane space. Based on homology modeling with characterized carriers, SCRG_05595 likely features the characteristic three-fold pseudo-symmetry and contains signature motifs found in mitochondrial carriers.

For preliminary structural analysis, researchers should:

  • Perform sequence alignment with characterized mitochondrial carriers

  • Use predictive tools such as TMHMM for transmembrane domain prediction

  • Apply homology modeling using solved structures of other mitochondrial carriers

  • Validate predictions through limited proteolysis and topology mapping experiments

What approaches should be used to confirm the mitochondrial localization of SCRG_05595?

Confirming the mitochondrial localization of SCRG_05595 requires multiple complementary approaches:

Microscopy-based confirmation:

  • Express SCRG_05595 with a C-terminal GFP or other fluorescent tag from its endogenous locus

  • Perform co-localization studies with established mitochondrial markers like Tom70-mCherry

  • Use super-resolution microscopy to determine precise submitochondrial localization

Biochemical verification:

  • Perform subcellular fractionation and western blotting

  • Use protease protection assays to determine membrane topology

  • Conduct import assays with isolated mitochondria

Based on mitochondrial protein localization studies in S. cerevisiae, it's critical to verify that the observed localization is not affected by mitochondrial membrane potential disruption, as many mitochondrial proteins relocalize upon import failure .

How can I determine if SCRG_05595 contains a functional mitochondrial targeting sequence?

To determine if SCRG_05595 contains a functional mitochondrial targeting sequence (MTS):

  • In silico analysis:

    • Use predictive algorithms (MitoProt, TargetP) to identify potential N-terminal MTS

    • Analyze the sequence for characteristic features: positively charged, hydroxylated residues and ability to form amphipathic helices

  • Experimental verification:

    • Generate constructs with the predicted MTS fused to reporter proteins (GFP)

    • Create truncation mutants to map minimal targeting sequence

    • Perform site-directed mutagenesis of key residues

  • Import assays:

    • Conduct in vitro import assays with radiolabeled precursor proteins

    • Monitor processing of the precursor to mature form by mitochondrial processing peptidase

Studies have shown that the MTS is critical for recognition and degradation of non-imported mitochondrial proteins, making it essential to characterize this element in SCRG_05595 .

What methods are most effective for determining the substrate specificity of the uncharacterized carrier SCRG_05595?

Determining substrate specificity for uncharacterized mitochondrial carriers requires a multi-faceted approach:

1. Genetic approaches:

  • Create SCRG_05595 deletion strains and perform metabolic profiling

  • Conduct synthetic lethality screens to identify genetic interactions

  • Perform suppressor screens to identify metabolic pathways affected

2. Biochemical approaches:

  • Reconstitute purified SCRG_05595 into liposomes for transport assays

  • Perform metabolite loading experiments with radiolabeled substrates

  • Use metabolomics to identify accumulated or depleted metabolites in deletion strains

3. Structural approaches:

  • Identify substrate-binding residues through homology modeling

  • Perform site-directed mutagenesis of predicted binding residues

  • Use thermal shift assays to screen for metabolites that stabilize the protein

Experimental Design Table for Substrate Identification:

ApproachTechniqueAdvantagesLimitationsControls
GeneticDeletion phenotypingPhysiological contextCompensatory mechanismsComplementation with wild-type gene
BiochemicalLiposome reconstitutionDirect measurement of transportTechnically challengingKnown carrier-substrate pairs
MetabolomicsLC-MS/MS analysisComprehensive metabolite screeningIndirect evidenceComparison with related carrier knockouts
StructuralMolecular dockingPredicts binding modeRequires validationMutagenesis of predicted binding sites

How should I design experiments to investigate the potential role of SCRG_05595 in mitochondrial quality control pathways?

Based on recent findings about nuclear-based quality control for mitochondrial proteins, investigating SCRG_05595's potential role in these pathways requires:

  • Analysis of protein fate under mitochondrial stress:

    • Visualize SCRG_05595-GFP localization after treatment with FCCP to depolarize mitochondria

    • Determine if SCRG_05595 relocates to the nucleus, cytoplasm, or other compartments under stress conditions

    • Analyze precursor accumulation by western blotting to detect higher molecular weight forms

  • Investigation of degradation mechanisms:

    • Treat cells with proteasome inhibitors (MG-132) to assess stabilization

    • Create strains with mutations in E3 ubiquitin ligases (San1, Ubr1, Doa10) involved in nuclear protein quality control

    • Perform cycloheximide chase experiments to measure protein half-life under different conditions

  • Protein interaction studies:

    • Conduct BioID or proximity labeling to identify quality control factors that interact with SCRG_05595

    • Perform co-immunoprecipitation experiments under normal and stress conditions

    • Use yeast two-hybrid screens to identify potential interaction partners

The nuclear-based mitoprotein degradation (mitoNUC) pathway has been shown to be critical for non-imported mitochondrial proteins, making it essential to investigate SCRG_05595's potential interactions with this system .

What approaches can resolve conflicting subcellular localization data for SCRG_05595?

Resolving conflicting localization data requires systematic investigation:

  • Tag position analysis:

    • Compare N-terminal vs. C-terminal tagged constructs

    • Use small epitope tags (HA, FLAG) in addition to fluorescent proteins

    • Validate with untagged protein using specific antibodies

  • Conditional expression systems:

    • Use the RITE (Recombination-Induced Tag Exchange) system to distinguish between old and newly synthesized proteins

    • This approach can determine if observed nuclear localization is limited to newly synthesized proteins, as shown for other mitochondrial proteins

  • Fractionation validation:

    • Perform careful subcellular fractionation with multiple markers for each compartment

    • Assess precursor vs. mature forms in different cellular fractions

    • Use density gradient centrifugation for higher resolution separation

  • Perturbation analysis:

    • Compare localization under different conditions (fermentative vs. respiratory growth)

    • Examine effects of import machinery depletion (e.g., Tom40) as an alternative to chemical uncouplers

    • Analyze localization in different genetic backgrounds

Studies have shown that approximately 6.4% of mitochondrial proteins relocalize to the nucleus when mitochondrial import is compromised, highlighting the importance of examining SCRG_05595 under various conditions .

What are the optimal conditions for expressing recombinant SCRG_05595 in S. cerevisiae?

Optimizing expression of recombinant SCRG_05595 requires careful consideration of several factors:

Expression system selection:

  • Genomic integration vs. plasmid-based expression

  • Choice of promoter (constitutive vs. inducible)

  • Selection of appropriate strain background

Recommended expression conditions:

ParameterRecommendationRationaleConsiderations
PromoterGAL1 (inducible)Allows controlled expressionHigh expression may cause aggregation
MediaSynthetic complete lacking selection markerMaintains plasmid stabilitySwitch to galactose for induction
Growth phaseEarly to mid-log phaseOptimal mitochondrial developmentAvoid post-diauxic shift
Temperature30°COptimal for S. cerevisiae growthLower temperature (24°C) may improve folding
Induction time4-6 hoursSufficient for expressionLonger times may lead to degradation
Tag positionC-terminalAvoids interference with MTSVerify functionality with complementation

For membrane proteins like mitochondrial carriers, overexpression often leads to mislocalization or aggregation. Consider using the native promoter and genomic integration for more physiological expression levels. S. cerevisiae's sophisticated cytokinesis and budding mechanisms should be considered when designing growth and expression protocols .

How can I troubleshoot failed mitochondrial import of recombinant SCRG_05595?

When troubleshooting failed mitochondrial import of SCRG_05595:

  • Verify protein expression:

    • Confirm expression by western blot

    • Check for presence of precursor form (higher molecular weight)

    • Ensure the protein is not being rapidly degraded

  • Assess mitochondrial functionality:

    • Measure mitochondrial membrane potential using fluorescent dyes (TMRM, JC-1)

    • Verify functionality of import machinery components

    • Examine mitochondrial morphology for abnormalities

  • Analyze protein sequence and structure:

    • Confirm the MTS is not disrupted by mutations or tags

    • Check for hydrophobic sequences that might cause aggregation

    • Examine potential post-translational modifications affecting import

  • Test alternative conditions:

    • Vary growth conditions (fermentative vs. respiratory)

    • Modulate expression levels

    • Try different strain backgrounds

If mitochondrial import fails, investigate alternative localization patterns as described for other mitochondrial proteins. Research has shown that non-imported mitochondrial proteins can localize to the nucleus, cytoplasm, or ER, with distinct degradation mechanisms for each location .

What controls are essential when analyzing SCRG_05595 localization under mitochondrial stress conditions?

When analyzing SCRG_05595 localization under stress conditions, include these essential controls:

  • Positive controls for different localization patterns:

    • Include known proteins representing each potential fate:

      • Class 1 (nuclear localization): Use a protein like Ilv2

      • Class 2 (continued mitochondrial localization): Include Tom20

      • Class 3 (cytoplasmic accumulation): Include Acp1

      • Class 4 (ER localization): Include Mir1

      • Class 5 (reduced abundance): Include Cox15

  • Membrane potential controls:

    • Include both membrane potential-dependent and independent mitochondrial markers

    • Tom70-mCherry is ideal as it localizes to mitochondria regardless of membrane potential

  • Tag verification controls:

    • Compare GFP-tagged, differently tagged (FLAG, HA), and untagged native protein detection

    • This ensures observed localization is not an artifact of the tag

  • Import machinery controls:

    • Compare chemical uncoupling (FCCP) with genetic depletion of import machinery (Tom40)

    • This distinguishes general mitochondrial stress effects from specific import defects

  • Degradation pathway controls:

    • Include proteasome inhibition (MG-132)

    • Test cells lacking E3 ubiquitin ligases involved in different quality control pathways

How can I determine if SCRG_05595 is subject to the nuclear-associated mitoprotein degradation (mitoNUC) pathway?

To determine if SCRG_05595 is regulated by the mitoNUC pathway:

  • Localization analysis under import stress:

    • Visualize SCRG_05595-GFP after FCCP treatment or Tom40 depletion

    • Co-stain with nuclear markers to confirm nuclear localization

    • Perform nuclear fractionation to biochemically verify localization

  • Dependency on E3 ubiquitin ligases:

    • Generate strains lacking San1, Ubr1, and Doa10 individually and in combination

    • These E3 ligases work redundantly in the mitoNUC pathway

    • Assess SCRG_05595 stability in these backgrounds under mitochondrial stress

  • MTS dependency testing:

    • Create MTS deletion mutants of SCRG_05595

    • The MTS is necessary for degradation and toxicity in the mitoNUC pathway

    • Compare turnover rates of wild-type and MTS-deleted proteins

  • Nuclear sequestration analysis:

    • Examine formation of nuclear-associated protein foci under conditions of proteasome inhibition

    • These foci represent an alternative fate when degradation capacity is exceeded

    • Co-localize with known markers of nuclear quality control compartments

What advanced mass spectrometry approaches should be used to identify post-translational modifications of SCRG_05595?

For comprehensive PTM analysis of SCRG_05595:

  • Sample preparation strategies:

    • Enrich for specific modifications (phosphorylation, acetylation, ubiquitination)

    • Compare modifications under normal conditions vs. mitochondrial stress

    • Isolate different subcellular pools of the protein

  • Mass spectrometry techniques:

    • Use bottom-up proteomics with high-resolution MS/MS

    • Apply middle-down approaches for larger peptide analysis

    • Consider top-down proteomics for intact protein analysis

  • Fragmentation methods:

    • Higher-energy collisional dissociation (HCD) for general PTM mapping

    • Electron transfer dissociation (ETD) for labile modifications

    • Parallel reaction monitoring (PRM) for targeted quantification

Advanced PTM Analysis Workflow:

StageTechniquePurposeConsiderations
EnrichmentTiO₂ chromatographyPhosphopeptide enrichmentMay miss other modifications
IMACAlternative phosphopeptide enrichmentDifferent specificity profile
Ubiquitin remnant antibodyK-GG peptide enrichmentRequires trypsin digestion
FractionationHigh-pH reversed-phaseOrthogonal separationImproves coverage
SCX chromatographyCharge-based separationUseful for phosphopeptides
AnalysisLC-MS/MS with HCDGeneral PTM mappingGood for most modifications
LC-MS/MS with ETDPreserves labile PTMsLower sensitivity
QuantificationTMT labelingMultiplexed comparisonRatio compression concerns
Label-freeSimple workflowLower precision
Data AnalysisSite localization scoringPTM position confidenceEssential for ambiguous sites
Occupancy calculationFunctional relevanceRequires unmodified peptide data

How can structural biology techniques be applied to resolve the transport mechanism of SCRG_05595?

Elucidating the transport mechanism of SCRG_05595 requires integrated structural biology approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: Works well for membrane proteins, captures different conformational states

    • Challenges: Requires highly pure, stable protein preparations

    • Approach: Express SCRG_05595 with affinity tags, purify in suitable detergents or nanodiscs, and analyze by single-particle cryo-EM

  • X-ray crystallography:

    • Advantages: Potentially higher resolution than cryo-EM

    • Challenges: Membrane proteins are difficult to crystallize

    • Approach: Screen numerous crystallization conditions with purified protein, consider using antibody fragments to stabilize specific conformations

  • Molecular dynamics simulations:

    • Advantages: Can model substrate transport and conformational changes

    • Requirements: Needs initial structural model from experimental data

    • Approach: Build homology model based on related carriers, validate with experimental constraints, simulate transport process

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Advantages: Can identify conformational changes upon substrate binding

    • Approach: Compare deuterium uptake in presence/absence of potential substrates

    • Output: Identifies regions involved in substrate binding or conformational changes

  • Site-directed mutagenesis validation:

    • Systematically mutate residues predicted to be involved in substrate binding or translocation

    • Test mutants with transport assays to validate structural models

    • Create a structure-function relationship map

S. cerevisiae has been extensively used as a model organism for structural studies of membrane proteins, making these approaches particularly suitable for SCRG_05595 characterization .

What systems biology approaches can reveal the metabolic network context of SCRG_05595?

To place SCRG_05595 in its broader metabolic context:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from SCRG_05595 deletion strains

    • Identify perturbed pathways through enrichment analysis

    • Use time-course experiments to capture dynamic responses

  • Flux analysis:

    • Perform 13C metabolic flux analysis to quantify changes in metabolic fluxes

    • Compare wild-type and SCRG_05595 deletion strains under different conditions

    • Identify metabolic rerouting that occurs to compensate for carrier absence

  • Network analysis:

    • Construct protein-protein interaction networks around SCRG_05595

    • Identify synthetic lethal interactions through genome-wide screens

    • Map genetic interactions to biochemical pathways

  • Comparative genomics:

    • Analyze conservation patterns across species

    • Identify co-evolution with other metabolic components

    • Use phylogenetic profiling to predict functional associations

S. cerevisiae's well-characterized metabolic network makes it an ideal system for placing uncharacterized carriers like SCRG_05595 into their functional context .

How can I design experiments to determine if SCRG_05595 plays a role in cellular aging or mitochondrial stress response?

To investigate SCRG_05595's potential role in aging or stress response:

  • Replicative and chronological aging assays:

    • Compare lifespan of wild-type and SCRG_05595 deletion strains

    • Analyze age-dependent changes in SCRG_05595 expression and localization

    • Test if overexpression impacts lifespan

  • Stress resistance phenotyping:

    • Challenge cells with various stressors:

      • Oxidative stress (H₂O₂, paraquat)

      • Metabolic stress (carbon source switching)

      • Protein folding stress (heat shock, tunicamycin)

    • Measure growth, viability, and recovery rates

  • Mitochondrial function assessment:

    • Measure respiration rates, membrane potential, and ROS production

    • Analyze mitochondrial morphology and dynamics

    • Assess mitophagy rates under normal and stress conditions

Recent research has shown that nuclear accumulation of non-imported mitochondrial precursors increases during cellular aging, suggesting a potential connection between mitochondrial protein import, quality control, and the aging process .

What computational approaches can predict functional partners of SCRG_05595?

To predict functional partners of SCRG_05595:

  • Co-expression network analysis:

    • Analyze large-scale transcriptomics datasets to identify genes with similar expression patterns

    • Focus on datasets covering various stress conditions and metabolic states

    • Use weighted gene co-expression network analysis (WGCNA) to identify modules containing SCRG_05595

  • Protein-protein interaction prediction:

    • Apply machine learning approaches trained on known interactions

    • Consider structural features that predict membrane protein interactions

    • Use co-evolution analysis to identify potentially interacting residues

  • Metabolic modeling:

    • Incorporate SCRG_05595 into genome-scale metabolic models

    • Perform flux balance analysis with varying constraints

    • Identify reactions whose fluxes are sensitive to SCRG_05595 activity

  • Text mining and knowledge integration:

    • Apply natural language processing to extract relationships from literature

    • Integrate data from multiple databases

    • Use semantic similarity measures to identify functionally related proteins

S. cerevisiae's extensive -omics datasets and well-annotated genome make it particularly amenable to computational function prediction approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.