Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial carrier SCY_1795 (SCY_1795)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SCY_1795; Uncharacterized mitochondrial carrier SCY_1795
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SCY_1795
Target Protein Sequence
MANQNSDLYKQITAGSVAAVFQTTMTYPFEYLKTGLQLQPKGTAFEIILPQIKSYFVGCS ALNVAAFGKTILRFVTFDKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPF ENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHNMATKSTPVARIEKLLPAVKHMYQTRGP AAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSVITGLATSFTLVAMTQPID VVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVS LLLGFSSRS
Uniprot No.

Target Background

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SCY_1795 and how is it classified within the mitochondrial carrier family?

SCY_1795 is an uncharacterized mitochondrial carrier protein from Saccharomyces cerevisiae consisting of 309 amino acids . It belongs to the Mitochondrial Carrier Family (MCF), which forms part of the larger Solute Carrier (SLC) superfamily of membrane transport proteins. Mitochondrial carriers typically contain six transmembrane domains with characteristic sequence motifs and are responsible for transporting various metabolites, nucleotides, and cofactors across the inner mitochondrial membrane .

Methodological approaches for classification of uncharacterized carriers like SCY_1795 typically involve:

  • Sequence alignment with known carriers

  • Phylogenetic analysis to establish evolutionary relationships

  • Structural prediction using computational tools

  • Expression pattern analysis under various conditions

Despite classification as a mitochondrial carrier based on sequence homology, SCY_1795 remains functionally uncharacterized, which is common for many members of this protein family .

What are the common challenges in working with uncharacterized mitochondrial carriers like SCY_1795?

Several technical challenges have hindered the characterization of many mitochondrial carriers including SCY_1795:

  • Low immunogenicity leading to difficulty in generating specific antibodies

  • Low endogenous expression levels making detection challenging

  • Polytopic membrane proteins are difficult to solubilize and purify while maintaining native conformation

  • High interspecies conservation making it difficult to generate species-specific antibodies

  • Transport assays are tedious and limited by substrate availability

Methods to overcome these challenges include:

  • Using epitope tags (such as His-tag as seen with recombinant SCY_1795)

  • Heterologous overexpression systems

  • Liposome reconstitution for functional assays

  • Proximity labeling for interaction studies

  • CRISPR-Cas9 genome editing for functional studies in vivo

What expression systems are commonly used for recombinant production of SCY_1795?

Various expression systems can be employed for the production of recombinant mitochondrial carriers with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsExample Applications
E. coliHigh yield, cost-effective, rapid growthLack of eukaryotic post-translational modificationsStructural studies, antibody generation
S. cerevisiaeNative environment, proper foldingLower yield than E. coliFunctional studies in native context
P. pastorisHigh yield, eukaryotic systemMore complex than E. coliScale-up production
Insect cellsHigher eukaryotic systemMore expensive, slowerStudies requiring complex modifications
Mammalian cellsNative-like modificationsMost expensive, lowest yieldStudies requiring mammalian-like environment

For SCY_1795, E. coli has been used as an expression system for producing recombinant protein with a His-tag . This suggests bacterial expression is sufficient for at least some applications, though functional studies might benefit from expression in yeast systems.

How do experimental design considerations affect SCY_1795 research?

When designing experiments to study SCY_1795, several methodological principles should be followed:

  • Statistical power considerations:

    • Perform appropriate power analysis to determine sample size

    • Ensure adequate replication to detect biologically relevant effects

    • Account for variability in biological systems

  • Avoiding pseudoreplication:

    • Design experiments with true biological replicates

    • Consider hierarchical data structure in statistical analysis

    • Ensure independent sampling

  • Controls and validation:

    • Include appropriate positive and negative controls

    • Validate findings with complementary methodologies

    • Consider potential confounding variables

  • Systematic approach:

    • Develop clear hypotheses based on known mitochondrial carrier functions

    • Use a range of experimental conditions to identify functional contexts

    • Integrate multiple data types (genomic, proteomic, metabolomic)

These principles ensure robust, reproducible research on SCY_1795, helping to avoid questionable research practices and promoting transparency in experimental design .

How can SCY_1795 be detected and localized in cellular systems?

Detection and localization of SCY_1795 requires specialized approaches due to the challenges inherent in studying membrane proteins:

  • Antibody-based detection:

    • Generation of specific antibodies against SCY_1795 peptides

    • Use of epitope tags (His-tag, FLAG, etc.) when native antibodies are unavailable

    • Western blotting of subcellular fractions to confirm mitochondrial localization

  • Fluorescence microscopy:

    • Fusion with fluorescent proteins (GFP, mCherry) at N- or C-terminus

    • Co-localization with established mitochondrial markers

    • Live-cell imaging to monitor dynamics

  • Proteomic approaches:

    • Mass spectrometry analysis of purified mitochondrial fractions

    • Proximity-based labeling techniques (BioID, APEX)

    • Protein correlation profiling

  • Biochemical fractionation:

    • Differential centrifugation to isolate mitochondria

    • Protease protection assays to determine membrane topology

    • Carbonate extraction to distinguish integral from peripheral membrane proteins

Proper localization studies are critical as they provide the foundation for functional characterization and ensure that observed phenotypes are indeed related to the mitochondrial functions of SCY_1795.

What experimental approaches are most effective for characterizing the substrate specificity of SCY_1795?

Determining substrate specificity is critical for understanding the function of uncharacterized carriers like SCY_1795. A multi-faceted approach is recommended:

  • Transport assays with reconstituted proteoliposomes:

    • Purify recombinant SCY_1795 (available as His-tagged protein)

    • Reconstitute into liposomes with defined lipid composition

    • Test transport of radiolabeled or fluorescently labeled potential substrates

    • Measure substrate exchange, uptake kinetics, and inhibition profiles

  • Genetic approaches:

    • Generate SCY_1795 deletion strains in S. cerevisiae

    • Perform phenotypic analysis under various metabolic conditions

    • Conduct complementation studies with known carriers

    • Identify synthetic genetic interactions through genome-wide screens

  • Evolutionary and computational analysis:

    • Conduct comparative genomics across species

    • Identify conserved residues likely involved in substrate binding

    • Use homology modeling based on structurally characterized carriers

    • Apply molecular docking to predict substrate binding

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and SCY_1795-deleted strains

    • Identify accumulated or depleted metabolites as candidate substrates

    • Perform isotope labeling studies to track metabolic flux

It's important to note that mitochondrial carriers can display substrate promiscuity. For example, carriers initially thought to transport specific substrates were later found to transport additional compounds, such as AtUCP1 and AtUCP2 in Arabidopsis, which transport amino acids, dicarboxylates, phosphate, sulfate, and thiosulfate .

How can protein-protein interaction studies help elucidate the function of SCY_1795?

Protein-protein interactions can provide crucial insights into functional roles of uncharacterized proteins like SCY_1795:

  • Affinity purification-mass spectrometry (AP-MS):

    • Purify His-tagged SCY_1795 under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Distinguish specific interactions from background using quantitative approaches

    • Validate interactions through reciprocal purifications

  • Proximity-based labeling:

    • Express SCY_1795 fused to BioID or APEX2 in yeast

    • Allow in vivo labeling of proximal proteins

    • Identify labeled proteins by mass spectrometry

    • Map the protein neighborhood within mitochondria

  • Split-reporter assays:

    • Test binary interactions using split-ubiquitin or split-GFP systems

    • Screen against libraries of mitochondrial proteins

    • Validate in native context using co-immunoprecipitation

  • Genetic interaction mapping:

    • Perform synthetic genetic array analysis with SCY_1795 deletion

    • Identify genes showing epistatic relationships

    • Connect to known mitochondrial pathways and functions

This multi-faceted approach can place SCY_1795 within functional complexes or pathways, helping overcome the limitations of traditional transport assays for uncharacterized carriers.

How do mitochondrial carrier proteins like SCY_1795 contribute to cellular metabolism?

Mitochondrial carriers play essential roles in cellular metabolism by facilitating the exchange of metabolites between mitochondrial and cytosolic compartments:

  • Metabolite transport functions:

    • Nucleotide transport (e.g., ADP/ATP exchange by AAC)

    • Substrate transport for TCA cycle (e.g., pyruvate, malate)

    • Cofactor transport (e.g., NAD+, coenzyme A)

    • Ion homeostasis (e.g., calcium, phosphate)

  • Role in bioenergetics:

    • Support of oxidative phosphorylation

    • Uncoupling of respiration from ATP synthesis (UCPs)

    • Regulation of mitochondrial membrane potential

    • Modulation of reactive oxygen species production

  • Integration with cellular signaling:

    • Retrograde signaling from mitochondria to nucleus

    • Response to metabolic stress conditions

    • Coordination of mitochondrial and cytosolic metabolism

  • Pathophysiological implications:

    • Mitochondrial dysfunction in disease states

    • Metabolic adaptations during stress

    • Cellular responses to nutrient availability

While SCY_1795 remains uncharacterized, studies of other carriers provide a framework for investigating its potential roles. Notably, some carriers like Pic2p, originally thought to be phosphate carriers, were later shown to transport copper instead , highlighting the importance of experimental verification for predicted functions.

What can evolutionary analysis reveal about the potential function of SCY_1795?

Evolutionary analysis provides valuable insights into the function of uncharacterized proteins like SCY_1795:

  • Phylogenetic profiling:

    • Map presence/absence of SCY_1795 homologs across species

    • Correlate with metabolic capabilities of different organisms

    • Identify co-evolution with specific metabolic pathways

  • Sequence conservation analysis:

    • Identify highly conserved residues likely crucial for function

    • Detect substrate-binding motifs shared with characterized carriers

    • Map conservation onto structural models to identify functional domains

  • Evolutionary rate analysis:

    • Compare substitution rates with other mitochondrial carriers

    • Identify constraints indicating functional importance

    • Detect signatures of positive selection suggesting adaptive evolution

  • Comparative genomic context:

    • Analyze genomic neighborhood across species

    • Identify operonic arrangements in prokaryotic homologs

    • Detect co-regulation patterns with functionally related genes

This evolutionary perspective can guide functional hypotheses and experimental design, particularly for targeting conserved residues for mutagenesis or identifying potential substrates based on metabolic context.

How can CRISPR-Cas9 technology be utilized to study the physiological role of SCY_1795?

CRISPR-Cas9 technology offers powerful approaches for investigating the function of SCY_1795:

  • Precise genome editing:

    • Generate complete deletion of SCY_1795

    • Introduce point mutations in conserved residues

    • Create tagged versions at the endogenous locus

    • Engineer conditional expression systems

  • Functional screening:

    • Conduct genome-wide CRISPR screens in SCY_1795 mutant background

    • Identify synthetic lethal or suppressor interactions

    • Map genetic interaction networks

    • Connect to known mitochondrial pathways

  • Regulatory studies:

    • Edit promoter or regulatory elements of SCY_1795

    • Create reporter fusions to monitor expression

    • Identify transcription factors controlling expression

    • Study condition-dependent regulation

  • In vivo dynamics:

    • Tag endogenous SCY_1795 with fluorescent proteins

    • Monitor localization and dynamics under different conditions

    • Assess protein turnover and stability

    • Investigate post-translational modifications

These approaches can be particularly valuable for connecting genotype to phenotype in the context of an uncharacterized protein like SCY_1795, especially when combined with physiological and biochemical analyses.

How do circular DNA elements impact the study of mitochondrial carriers in evolved yeast strains?

Circular DNA elements can significantly impact genetic studies and should be considered when studying mitochondrial carriers in evolved strains:

  • Gene amplification mechanisms:

    • Extrachromosomal circular DNA (eccDNA) can form during adaptive evolution

    • Amplification can occur even in regions without pre-existing repetitive sequences

    • Detection requires Southern blot analysis or specialized PCR approaches

  • Impact on experimental interpretation:

    • Increased copy number can lead to higher expression levels

    • Phenotypic effects may be due to dosage rather than sequence changes

    • Stability of circular elements may vary under different conditions

  • Evolutionary significance:

    • Circular DNA formation represents an adaptive mechanism in yeast

    • Can provide rapid amplification of beneficial genes

    • May offer insights into evolutionary dynamics of mitochondrial carriers

  • Detection methods:

    • PCR with divergent primers to detect circular junctions

    • Whole genome sequencing to identify copy number variations

    • Serial sampling during evolution to track emergence of amplifications

In studies of SCY_1795, monitoring for potential gene amplification through circular DNA formation would be important, particularly in evolution experiments or when analyzing industrial strains under selection pressure.

What are the challenges in structural determination of mitochondrial carriers like SCY_1795?

Structural studies of mitochondrial carriers present significant challenges:

  • Expression and purification obstacles:

    • Low natural abundance requiring recombinant expression

    • Maintaining protein stability during extraction from membranes

    • Selecting appropriate detergents or membrane mimetics

    • Achieving sufficient purity and homogeneity

  • Crystallization difficulties:

    • Conformational heterogeneity of transport proteins

    • Limited polar surfaces for crystal contacts

    • Detergent micelles interfering with crystallization

    • Dynamic nature of carriers undergoing conformational changes

  • Alternative structural approaches:

    • Cryo-electron microscopy for membrane proteins

    • Nuclear magnetic resonance for specific domains

    • Mass spectrometry-based structural proteomics

    • Molecular dynamics simulations based on homology models

  • Structure-function analysis:

    • Site-directed mutagenesis of conserved residues

    • Transport assays with mutant variants

    • Binding studies with potential substrates

    • Computational docking and molecular dynamics

For SCY_1795, the availability of recombinant His-tagged protein provides a starting point for structural studies, though extensive optimization would be required to overcome the inherent challenges of membrane protein structural biology.

How should researchers interpret conflicting data when characterizing SCY_1795?

When faced with conflicting data during SCY_1795 characterization, researchers should employ systematic approaches to resolve discrepancies:

  • Methodological considerations:

    • Evaluate differences in experimental conditions

    • Assess technical limitations of different assays

    • Consider the sensitivity and specificity of detection methods

    • Determine if observations are direct or indirect

  • Biological explanations:

    • Evaluate substrate promiscuity (common in mitochondrial carriers)

    • Consider context-dependent functions

    • Assess potential post-translational modifications

    • Investigate strain-specific differences

  • Integrative analysis:

    • Combine data from multiple experimental approaches

    • Weigh evidence based on methodological robustness

    • Generate testable hypotheses to resolve conflicts

    • Use orthogonal validation techniques

  • Systematic validation:

    • Design controlled experiments to directly test conflicts

    • Use genetic complementation with mutant variants

    • Perform structure-function analyses of key residues

    • Consider evolutionary conservation data

Importantly, researchers should recognize that apparently conflicting data may reflect biological reality. For example, carriers initially identified as phosphate transporters were later shown to also transport copper , demonstrating that unexpected substrate versatility can explain seemingly contradictory results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.