Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial carrier YFR045W (YFR045W)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Properties of YFR045W Protein

PropertyDescription
Protein NameUncharacterized mitochondrial carrier YFR045W
Gene NameYFR045W
OrganismSaccharomyces cerevisiae
Length309 amino acids
UniProt IDP43617
Cellular LocationMitochondrial inner membrane
Protein FamilyMitochondrial carrier family
FunctionPutative transport protein

Recombinant Production and Characteristics

For research purposes, YFR045W is commonly produced as a recombinant protein in Escherichia coli (E. coli) expression systems . The recombinant form typically includes a histidine tag (His-tag) at the N-terminus to facilitate purification through affinity chromatography. The expression of the full-length protein (amino acids 1-309) in E. coli allows for the production of significant quantities of the protein for various biochemical and structural studies .

The recombinant YFR045W protein is typically supplied as a lyophilized powder, which provides stability during storage and transportation . For experimental use, the protein requires reconstitution in an appropriate buffer solution. The recommended procedure involves brief centrifugation of the vial prior to opening, followed by reconstitution in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, it is advised to add glycerol (5-50% final concentration) and store aliquots at -20°C/-80°C to prevent repeated freeze-thaw cycles that could compromise protein integrity .

Biological Function and Role

Despite being classified as an "uncharacterized" protein, some insights into the function of YFR045W have emerged through various genetic and biochemical studies. As a member of the mitochondrial carrier family, YFR045W is presumed to function as a transporter of specific metabolites across the mitochondrial inner membrane, contributing to the exchange of substrates between the mitochondrial matrix and the cytosol .

Protein Interactions and Networks

Understanding the interaction partners of YFR045W provides valuable insights into its potential functions and the biological pathways in which it participates. Both protein-protein interactions and protein-RNA interactions have been investigated for YFR045W.

Protein-Protein Interactions

According to the STRING database, YFR045W has several predicted functional partners, suggesting potential roles in specific cellular pathways . Some of the most significant predicted interaction partners include:

Table 3: Predicted Protein Interaction Partners of YFR045W

ProteinDescriptionInteraction Score
YPR011CUncharacterized mitochondrial carrier; major substrates are adenosine 5'-phosphosulfate (APS) and 3'-phospho-adenosine 5'-phosphosulfate (PAPS)0.843
HEM25Mitochondrial glycine transporter; required for transport of glycine into mitochondria for heme biosynthesis0.806
AAC3Mitochondrial inner membrane ADP/ATP translocator; exchanges cytosolic ADP for mitochondrially synthesized ATP0.726
UBS1Ubiquitin-conjugating enzyme suppressor that regulates Cdc34p0.632
CRC1Mitochondrial inner membrane carnitine transporter; required for carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria during fatty acid beta-oxidationNot specified

The high interaction scores with other mitochondrial carrier proteins, particularly YPR011C, HEM25, and AAC3, suggest that YFR045W may function in related transport processes or may be regulated by similar mechanisms . The interaction with CRC1, a mitochondrial carnitine transporter involved in fatty acid metabolism, hints at a potential role for YFR045W in metabolic pathways related to energy production or lipid metabolism .

Protein-RNA Interactions

Analysis of potential protein-RNA interactions using the RNAct database reveals that YFR045W may interact with various RNA molecules, although the prediction scores suggest relatively weak interactions . The highest prediction scores were observed for interactions with NSR1 (15.61) and YML009W-B (15.31) .

Table 4: Predicted RNA Interaction Partners of YFR045W

RNA GeneRNA Transcript LengthPrediction ScorePrediction z-Score
NSR11245 nt15.610.09
YML009W-B477 nt15.310.04
NOP1984 nt14.77-0.05
MDJ11536 nt14.2-0.14
YKL036C393 nt13.2-0.3

Research Applications and Future Directions

The recombinant YFR045W protein serves as a valuable tool for investigating the structure, function, and interactions of this mitochondrial carrier protein. Some key applications include:

  1. Structural Studies: The purified recombinant protein can be used for crystallography or cryo-electron microscopy to determine its three-dimensional structure, providing insights into the transport mechanism.

  2. Biochemical Characterization: In vitro transport assays using the recombinant protein reconstituted into liposomes can help identify the specific substrates transported by YFR045W.

  3. Interaction Studies: The recombinant protein can be used in pull-down assays, co-immunoprecipitation, or surface plasmon resonance experiments to validate predicted protein-protein interactions and identify new interaction partners.

  4. Antibody Production: The purified recombinant protein can serve as an antigen for generating specific antibodies against YFR045W, which can be used for localization studies, immunoprecipitation, or Western blotting.

Future research directions might include:

  1. Substrate Identification: Determining the specific metabolites transported by YFR045W would provide critical insights into its physiological role.

  2. Regulatory Mechanisms: Investigating how the activity of YFR045W is regulated in response to different metabolic conditions or cellular stresses.

  3. Structure-Function Relationships: Identifying key residues involved in substrate binding and transport through mutagenesis studies.

  4. Role in Cellular Metabolism: Further exploring the connection between YFR045W function and chitin synthesis or other aspects of cell wall biogenesis.

  5. Comparative Analysis: Investigating potential homologs of YFR045W in other organisms to understand the evolutionary conservation and diversification of its function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery details, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YFR045W; Uncharacterized mitochondrial carrier YFR045W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YFR045W
Target Protein Sequence
MANQNSDLYKQITAGSVAAVFQTTMTYPFEYLKTGLQLQPKGTAFEIILPQIKSYFVGCS ALNVAAFGKTILRFVTFDKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPF ENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVARIEKLLPAVKHMYQTRGP AAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSVITGLATSFTLVAMTQPID VVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVS LLLGFSSRS
Uniprot No.

Target Background

Database Links

KEGG: sce:YFR045W

STRING: 4932.YFR045W

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is YFR045W and why is it significant in S. cerevisiae research?

YFR045W is an uncharacterized mitochondrial carrier protein in Saccharomyces cerevisiae. Its significance stems from being part of the mitochondrial carrier family, which facilitates the transport of metabolites across the inner mitochondrial membrane. Understanding YFR045W function is particularly important as S. cerevisiae serves as an excellent model organism for studying fundamental eukaryotic processes, especially those related to mitochondrial function. S. cerevisiae is widely used as a proxy for studying biological pathways and processes conserved across species, including humans . The study of uncharacterized mitochondrial carriers like YFR045W can provide insights into cellular respiration, metabolite transport mechanisms, and mitochondrial diseases.

How do I design an initial experiment to characterize the function of YFR045W?

When designing an initial experiment to characterize YFR045W, follow these methodological steps:

  • Define your variables clearly:

    • Independent variable: YFR045W expression (wild-type, knockout, overexpression)

    • Dependent variables: Growth rates, metabolite profiles, respiration rates

    • Control variables: Growth conditions, media composition, temperature

  • Formulate testable hypotheses:

    • Null hypothesis (H₀): YFR045W deletion does not affect mitochondrial function

    • Alternative hypothesis (H₁): YFR045W deletion impairs specific mitochondrial transport functions

  • Select appropriate experimental approaches:

    • Gene deletion using CRISPR-Cas9 or homologous recombination

    • Complementation analysis with controlled expression systems

    • Growth phenotyping under various carbon sources and conditions

  • Control for confounding variables:

    • Use isogenic strains differing only in YFR045W status

    • Maintain identical growth conditions across experiments

    • Include appropriate positive and negative controls

The experimental design should incorporate randomization of samples and treatments to minimize systematic bias, as randomization is critical for valid statistical analysis of results .

What expression systems are most suitable for studying YFR045W in S. cerevisiae?

The most suitable expression systems for studying YFR045W include:

Table 1: Comparison of Expression Systems for YFR045W Studies

Expression SystemAdvantagesLimitationsBest Applications
Constitutive Promoters (e.g., TEF1, GPD)Continuous expression; simple experimental setupCannot control expression timing; potential toxicityInitial functional screening; complementation studies
Inducible Promoters (e.g., GAL1, CUP1)Controllable expression; reduces selection pressureInducers may affect metabolism; background expressionStudying dose-dependent effects; toxic protein expression
Repressible Promoters (e.g., MET25)Down-regulation when needed; useful for essential genesMetabolic effects of repressor conditionsStudying phenotypes after protein depletion
Genomic IntegrationStable expression; physiological levelsTime-consuming construction; fixed expression levelLong-term studies; accurate phenotyping

When choosing an expression system, consider that YFR045W is involved in mitochondrial function. S. cerevisiae exhibits distinct responses to different carbon sources, with respiratory proteins being induced during growth on non-fermentable carbon sources like xylose . Therefore, expression systems that allow precise control of YFR045W levels under both fermentative and respiratory conditions would be optimal for comprehensive characterization.

How can I optimize growth conditions to study YFR045W's role in respiratory versus fermentative metabolism?

Optimizing growth conditions requires a systematic approach to distinguish YFR045W's role in different metabolic states:

  • Media selection and carbon source optimization:

    • For fermentative metabolism: Use glucose-rich media (2% glucose YPD)

    • For respiratory metabolism: Use non-fermentable carbon sources (e.g., glycerol, ethanol, xylose)

    • For transitional studies: Use glucose-limited media (0.1% glucose)

  • Oxygen availability control:

    • High aeration: Use baffled flasks with low culture volumes and high agitation

    • Oxygen limitation: Use sealed vessels with controlled headspace

  • Growth monitoring protocol:

    • Track growth using both optical density (OD₆₀₀) measurements and viable cell counts

    • Measure growth rates during exponential phase under different conditions

    • Document diauxic shift timing in mixed carbon source media

  • Experimental validation:

    • Monitor expression of known respiratory genes (e.g., HAP4, COX genes) as positive controls

    • Check for induction of hexokinase HXK1, which increases >7-fold when cells are grown on non-fermentable carbon sources

Research has demonstrated that S. cerevisiae engineered for xylose metabolism shows significant upregulation of genes involved in the tricarboxylic acid cycle and respiration when grown on xylose compared to glucose, especially under oxygen-limited conditions . This respiratory response pattern could serve as a framework for investigating YFR045W's specific role in mitochondrial transport.

What transcriptomic approaches are most effective for understanding YFR045W regulation?

For effective transcriptomic analysis of YFR045W regulation, consider these methodological approaches:

  • RNA-Seq analysis protocol:

    • Extract total RNA from wild-type and YFR045W mutant strains under different growth conditions

    • Perform poly-A selection for mRNA enrichment

    • Generate cDNA libraries with unique barcodes for condition identification

    • Sequence using high-throughput platforms with >20 million reads per sample

    • Analyze differential expression using DESeq2 or similar tools

  • Time-course experimental design:

    • Collect samples at multiple timepoints during growth phase transitions

    • Include critical metabolic shift points (diauxic shift, respiratory adaptation)

    • Compare expression patterns across different carbon sources (glucose vs. xylose)

  • Co-expression network analysis:

    • Identify genes with expression patterns correlated with YFR045W

    • Cluster genes by functional categories and cellular processes

    • Map potential regulatory interactions using existing databases

  • Validation strategies:

    • Confirm key expression changes using RT-PCR

    • Compare GeneChip and RT-PCR results for validation as demonstrated in previous studies

    • Examine promoter regions for common regulatory elements

Previous research on S. cerevisiae has shown that expression analysis methods like GeneChip studies and RT-PCR produce nearly identical results when properly implemented, providing complementary validation approaches .

What approaches can I use to determine YFR045W's substrate specificity as a mitochondrial carrier?

To determine YFR045W's substrate specificity, implement these methodological approaches:

  • Reconstitution in liposomes:

    • Express and purify YFR045W protein with appropriate tags

    • Reconstitute purified protein in liposomes with controlled lipid composition

    • Perform transport assays with radioactively labeled potential substrates

    • Measure substrate uptake rates under various conditions

  • In vivo metabolite profiling:

    • Compare metabolite profiles between wild-type and YFR045W knockout strains

    • Use targeted metabolomics focusing on mitochondrial metabolites

    • Apply untargeted metabolomics to identify unexpected substrate candidates

  • Structural modeling and docking simulations:

    • Generate homology models based on characterized mitochondrial carriers

    • Perform in silico docking studies with potential substrates

    • Identify critical residues for substrate binding

    • Validate through site-directed mutagenesis

  • Genetic interaction screening:

    • Perform synthetic genetic array (SGA) analysis with YFR045W deletion

    • Identify genetic interactions with known mitochondrial transport pathways

    • Validate interactions through double mutant phenotype analysis

Table 2: Potential YFR045W Substrates Based on Other Mitochondrial Carriers

Substrate CategoryExample SubstratesDetection MethodAssociated Pathways
NucleotidesATP, ADP, AMPHPLC, LC-MS/MSEnergy metabolism, Replication
Amino acidsGlutamate, ArginineAmino acid analyzer, LC-MSProtein synthesis, Nitrogen metabolism
Carboxylic acidsMalate, CitrateGC-MS, Enzymatic assaysTCA cycle, Gluconeogenesis
CofactorsNAD+, FADFluorescence assays, LC-MSRedox reactions, Dehydrogenase functions
Phosphorylated compoundsPhosphate, PyrophosphateRadioactive P³² assaysEnergy transfer, Signal transduction

How should I design experiments to distinguish between direct and indirect effects of YFR045W deletion?

Distinguishing between direct and indirect effects requires sophisticated experimental design:

  • Conditional expression systems:

    • Use tetracycline-repressible promoters for controlled YFR045W depletion

    • Implement time-course experiments following YFR045W repression

    • Analyze early versus late transcriptional and metabolic responses

    • Identify immediate versus adaptive changes

  • Complementation strategies:

    • Rescue YFR045W knockout with wild-type and mutated versions

    • Test complementation with orthologous carriers from other species

    • Analyze domain-specific contributions using chimeric proteins

    • Implement site-directed mutagenesis of conserved residues

  • Multi-omics integration approach:

    • Correlate transcriptomic, proteomic, and metabolomic data

    • Apply temporal analysis to identify causality in regulatory networks

    • Use statistical modeling to separate primary from secondary effects

    • Implement pathway enrichment analysis for affected processes

  • Specificity controls:

    • Generate multiple independent knockout lines to control for off-target effects

    • Compare phenotypes with knockouts of other mitochondrial carriers

    • Perform rescue experiments with increasing expression levels

    • Use specific inhibitors of known mitochondrial pathways

This methodological framework follows established experimental design principles where independent and dependent variables are clearly defined, confounding variables are controlled, and hypothesis testing follows a systematic approach .

How can I utilize respiration-deficient petite mutants to understand YFR045W function?

Respiration-deficient petite mutants provide valuable insights into YFR045W function through these approaches:

  • Generation and verification of petite mutants:

    • Create ρ⁰ mutants (complete mtDNA loss) using ethidium bromide treatment

    • Generate ρ⁻ mutants (partial mtDNA loss) through spontaneous selection

    • Verify respiratory deficiency through growth on non-fermentable carbon sources

    • Confirm mtDNA status by DAPI staining and PCR analysis

  • Comparative analysis protocols:

    • Compare growth rates and metabolic profiles between:

      • Wild-type + YFR045W

      • Wild-type - YFR045W

      • ρ⁰ + YFR045W

      • ρ⁰ - YFR045W

    • Analyze fermentation products (ethanol, glycerol, xylitol) under various conditions

    • Monitor expression of YFR045W in different genetic backgrounds

  • Functional assessment methodology:

    • Measure mitochondrial membrane potential using fluorescent dyes

    • Analyze mitochondrial morphology through fluorescence microscopy

    • Assess mitochondrial protein import efficiency

    • Examine metabolite accumulation patterns in different genetic contexts

Previous research has demonstrated that petite respiration-deficient mutants (ρ⁰) of engineered S. cerevisiae strains show altered metabolic patterns, including increased ethanol production and reduced xylitol accumulation from xylose, suggesting respiratory function influences carbon metabolism . This experimental paradigm can be applied to specifically investigate YFR045W's role in mitochondrial transport and metabolism.

What computational approaches can predict YFR045W function based on comparative genomics?

Implementing computational approaches for YFR045W functional prediction involves:

  • Sequence-based analysis methodology:

    • Perform phylogenetic analysis across diverse species

    • Identify conserved domains and critical residues

    • Apply position-specific scoring matrices to detect distant homologs

    • Use hidden Markov models for sensitive sequence pattern recognition

  • Structural prediction protocol:

    • Generate 3D models using homology modeling against known mitochondrial carriers

    • Validate models through energy minimization and Ramachandran plot analysis

    • Identify substrate-binding pockets through cavity analysis

    • Perform molecular dynamics simulations to assess conformational changes

  • Network-based function prediction:

    • Construct protein-protein interaction networks including YFR045W

    • Apply guilt-by-association approaches using known mitochondrial pathways

    • Integrate transcriptomic data to identify co-expressed genes

    • Use Bayesian networks to infer functional relationships

  • Comparative genomics strategy:

    • Analyze YFR045W conservation across 704 organisms as established in prior studies

    • Focus on organisms where S. cerevisiae serves as a good model for specific pathways

    • Identify synteny patterns and gene neighborhood conservation

    • Compare expression patterns of orthologs in different species

Research has established that S. cerevisiae can serve as an appropriate model for studying conserved biological processes across species, including humans . This comparative approach can reveal functional insights about YFR045W by examining its conservation patterns across evolutionarily diverse organisms.

How should I interpret conflicting phenotypic data in YFR045W mutant studies?

When facing conflicting phenotypic data, apply these methodological approaches:

  • Systematic validation protocol:

    • Repeat experiments with increased biological and technical replicates

    • Standardize growth conditions precisely across all experiments

    • Verify strain genotypes through PCR and sequencing

    • Test multiple independently generated mutant strains

  • Condition-dependent analysis:

    • Systematically vary experimental conditions (temperature, pH, carbon source)

    • Create condition matrices to identify context-dependent phenotypes

    • Perform time-course analyses to capture temporal differences

    • Document strain background effects through comprehensive phenotyping

  • Quantitative phenotyping approach:

    • Implement high-precision growth measurements using automated systems

    • Apply statistical methods designed for time-series data

    • Calculate growth parameters (lag phase, doubling time, maximum OD)

    • Use area under curve analyses for integrated phenotypic assessment

  • Genetic background effects analysis:

    • Test YFR045W mutations in multiple strain backgrounds

    • Create isogenic strain sets differing only in YFR045W status

    • Document epistatic interactions with key metabolic regulators

    • Control for secondary mutations through whole-genome sequencing

Table 3: Troubleshooting Matrix for Conflicting YFR045W Phenotypic Data

Conflicting ObservationPotential CausesValidation ApproachesResolution Strategies
Growth defects present in some experiments but not othersMedia batch variation; Temperature fluctuationsStandardize media preparation; Use temperature-controlled incubatorsCreate detailed protocols with environmental controls
Different metabolite profiles between labsExtraction method differences; Instrument calibrationUse identical extraction protocols; Include internal standardsPerform cross-laboratory validation studies
Variable gene expression responsesRNA quality differences; Reference gene instabilityImplement stringent RNA quality control; Use multiple reference genesDevelop consensus normalization methods
Inconsistent mitochondrial phenotypesPetite background mutations; mtDNA heteroplasmyScreen for respiratory competence; Quantify mtDNA copy numberGenerate new strains with verified mtDNA status

This analytical framework follows the principles of experimental design where careful control of extraneous variables and systematic analysis of confounding factors is essential for valid results .

What statistical approaches are most appropriate for analyzing YFR045W-related experimental data?

For robust statistical analysis of YFR045W-related data, implement these methodological approaches:

  • Experimental design statistical considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Implement randomization schemes to minimize batch effects

    • Use factorial designs to assess interaction effects between variables

    • Consider repeated measures designs for time-series experiments

  • Differential expression analysis:

    • Apply DESeq2 or EdgeR for RNA-Seq count data

    • Implement appropriate multiple testing corrections (FDR control)

    • Use standardized fold-change thresholds (>2-fold) with statistical significance

    • Compare results using multiple normalization methods

  • Multivariate data analysis protocol:

    • Apply principal component analysis (PCA) for dimensionality reduction

    • Implement hierarchical clustering to identify patterns in expression data

    • Use ANOVA for multi-factor experimental designs

    • Apply mixed-effects models for experiments with random and fixed factors

  • Reproducibility enhancement methods:

    • Implement bootstrapping to assess result stability

    • Use cross-validation for predictive models

    • Report effect sizes alongside p-values

    • Provide data transformation and normalization details

Previous research has established that transcriptomic analysis showing >2-fold changes in gene expression represents significant biological regulation, as demonstrated in studies of S. cerevisiae respiratory gene expression in response to different carbon sources .

How can I integrate transcriptomic, proteomic, and metabolomic data to fully characterize YFR045W function?

Multi-omics data integration for YFR045W characterization requires sophisticated analytical approaches:

  • Data preprocessing and normalization protocol:

    • Apply platform-specific normalization methods for each data type

    • Implement batch effect correction using ComBat or similar algorithms

    • Remove systematic biases through appropriate scaling methods

    • Filter low-quality or low-confidence measurements

  • Multi-omics integration methods:

    • Apply canonical correlation analysis (CCA) to identify relationships between datasets

    • Implement DIABLO or similar multi-block data integration approaches

    • Use network-based integration methods like SNF (Similarity Network Fusion)

    • Apply Bayesian data integration frameworks for probabilistic modeling

  • Pathway-level integration strategy:

    • Map all data types to common pathway frameworks (KEGG, Reactome)

    • Implement pathway enrichment analysis across all omics layers

    • Calculate pathway activity scores integrating multiple data types

    • Identify discordant and concordant pathway regulations

  • Visualization and interpretation approaches:

    • Create multi-omics heatmaps with hierarchical clustering

    • Implement Circos plots for circular visualization of integrated data

    • Use chord diagrams to show relationships between different data types

    • Develop pathway-specific visualizations focusing on mitochondrial processes

This integration approach follows established principles where systematic analysis of complex datasets requires appropriate statistical methods and experimental design considerations to control for confounding variables and establish causal relationships .

How can the study of YFR045W in S. cerevisiae inform our understanding of human mitochondrial carriers?

Translating YFR045W research to human health contexts involves these methodological approaches:

  • Comparative genomics implementation:

    • Identify human orthologs of YFR045W through reciprocal BLAST

    • Perform phylogenetic analysis to determine evolutionary relationships

    • Compare protein domains and critical residues across species

    • Assess conservation of regulatory elements

  • Functional complementation strategy:

    • Express human mitochondrial carriers in YFR045W-deleted S. cerevisiae

    • Assess restoration of phenotypes and metabolic functions

    • Create chimeric proteins with domains from human and yeast carriers

    • Test disease-associated variants of human carriers in yeast system

  • Disease-relevant model development:

    • Engineer yeast to express human disease mutations in YFR045W orthologs

    • Recreate pathological conditions through environmental or genetic modifications

    • Measure functional consequences on mitochondrial transport and metabolism

    • Screen for small molecules that rescue disease phenotypes

S. cerevisiae has been established as a good model organism for studying many biological processes relevant to humans . The high degree of conservation in basic cellular processes makes yeast particularly valuable for studying mitochondrial functions that are often implicated in human diseases.

What methodological approaches can help identify specific substrates transported by YFR045W?

For definitive substrate identification, implement these methodological approaches:

  • Direct transport assay protocol:

    • Purify YFR045W and reconstitute in proteoliposomes

    • Load liposomes with potential substrates

    • Measure efflux/influx rates using radioactive or fluorescent tracers

    • Determine kinetic parameters (Km, Vmax) for confirmed substrates

  • Metabolomic profiling methodology:

    • Compare metabolite accumulation between wild-type and YFR045W-deleted strains

    • Apply targeted and untargeted metabolomics approaches

    • Focus on mitochondrial, cytosolic, and extracellular fractions

    • Use stable isotope labeling to track metabolite flux

  • Heterologous expression system utilization:

    • Express YFR045W in Lactococcus lactis or E. coli membrane vesicles

    • Implement transport assays with controlled membrane potential

    • Screen diverse metabolite libraries for transport activity

    • Validate findings through competition assays

  • Structure-guided approach:

    • Generate high-quality structural models of YFR045W

    • Identify substrate-binding pocket and critical residues

    • Design mutations that alter substrate specificity

    • Validate through transport assays with mutated proteins

How can advanced genome editing techniques improve our studies of YFR045W function?

Implementing advanced genome editing for YFR045W studies involves these methodological approaches:

  • CRISPR-Cas9 implementation strategy:

    • Design specific gRNAs targeting YFR045W with minimal off-target effects

    • Create precise modifications (point mutations, deletions, insertions)

    • Implement inducible CRISPR systems for temporal control

    • Use base editors for specific nucleotide changes without double-strand breaks

  • Endogenous tagging protocol:

    • Add fluorescent tags to YFR045W for localization studies

    • Implement epitope tags for protein-protein interaction studies

    • Create degron-tagged versions for controlled protein degradation

    • Use split fluorescent protein systems to study protein-protein interactions

  • Promoter engineering approach:

    • Replace native promoter with synthetic controllable promoters

    • Create promoter libraries with varying expression levels

    • Implement tissue-specific promoters for heterologous systems

    • Design stress-responsive promoters to study condition-specific functions

  • Multiplex modification strategy:

    • Simultaneously modify YFR045W and interacting partners

    • Create strain libraries with combinatorial modifications

    • Implement automated phenotyping for high-throughput analysis

    • Apply machine learning for phenotype-genotype correlation analysis

These genome editing approaches provide unprecedented precision in genetic manipulation, allowing researchers to test specific hypotheses about YFR045W function through carefully designed experiments with appropriate controls and statistical analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.