Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial carrier YMR166C (YMR166C)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Saccharomyces cerevisiae Uncharacterized Mitochondrial Carrier YMR166C (YMR166C) is a protein encoded by the YMR166C gene, part of the mitochondrial carrier family (MCF) in baker’s yeast. While its precise physiological role remains under investigation, functional studies and structural analyses suggest involvement in mitochondrial substrate transport. This article synthesizes current research on its gene structure, recombinant production, and hypothesized biological roles.

Gene Information

  • Locus: YMR166C (chromosome XIII, Saccharomyces cerevisiae strain S288c)

  • Synonyms: MME1 (Mitochondrial Magnesium Exporter 1), YM8520.15C

  • UniProt ID: Q03829

Protein Structure

  • Length: 368 amino acids

  • Sequence Features: Contains three tandem repeats of ~100 amino acids, characteristic of mitochondrial carriers, with conserved transmembrane helices and substrate-binding motifs .

  • Structural Motifs: Signature mitochondrial carrier motif (P-X-[DE]-X-X-[RK]) critical for substrate recognition .

Substrate Specificity

Computational and mutagenesis studies classify YMR166C as a putative amino acid transporter based on conserved residues at substrate-binding contact points :

Contact PointResiduesProposed Role
Contact Point IY137, R182Substrate specificity (variable group interaction)
Contact Point IIR-K motifDistinguishes amino acid carriers from nucleotide/keto acid transporters

Deletion of YMR166C disrupts mitochondrial amino acid homeostasis, causing significant changes in cellular lysine, histidine, and arginine levels (p < 0.05) .

Controversial Designation as Magnesium Exporter

While some sources annotate YMR166C as a magnesium exporter (MME1) , experimental evidence from substrate-binding analyses and metabolic profiling does not support this role .

Expression and Purification

  • Expression System: Escherichia coli with N-terminal His-tag .

  • Purity: >90% (SDS-PAGE verified) .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -80°C .

Metabolic Impact of Deletion

  • Amino Acid Dysregulation: YMR166CΔ strains exhibit altered levels of lysine (+13-fold), histidine (+3.6-fold), and arginine (+5.9-fold) under minimal growth conditions .

  • Multivariate Analysis: Mahalanobis distance analysis confirms significant metabolic disruption (p < 0.001) .

Genetic Context and Artifacts

  • Proximity to MLH1: The YMR166C deletion strain’s mutator phenotype (247-fold increase in Hom+ reversion) is attributed to its proximity to the DNA repair gene MLH1 (YMR167w), not direct function .

Functional Clustering and Homology

YMR166C clusters metabolically with mitochondrial transporters involved in amino acid metabolism (e.g., YDL119c, YMC1) . Orthologous human mitochondrial carriers share conserved substrate-binding residues, suggesting evolutionary conservation of function .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this need in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MME1; YMR166C; YM8520.15C; Mitochondrial magnesium exporter 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YMR166C
Target Protein Sequence
MNSWNLSSSIPIIHTPHDHPPTSEGTPDQPNNNRKDDKLHKKRGDSDEDLSPIWHCVVSG GIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLG SFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQG RFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQL AFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVT HPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLYQMTLRG LSNAFPTD
Uniprot No.

Target Background

Function
This protein is a transporter located in the mitochondrial inner membrane. It facilitates the export of magnesium, playing a crucial role in regulating mitochondrial Mg(2+) homeostasis.
Gene References Into Functions
  1. This protein, Mme1, was identified as a mitochondrial Mg2+ exporter that collaborates with mitochondrial importers to precisely control mitochondrial Mg2+ homeostasis. PMID: 25585246
Database Links

KEGG: sce:YMR166C

STRING: 4932.YMR166C

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is YMR166C and where is it located in the S. cerevisiae genome?

YMR166C is an uncharacterized mitochondrial carrier protein in Saccharomyces cerevisiae. It is located 413 bp from MLH1 (YMR167w) on the opposite DNA strand . This proximity to MLH1, a critical mismatch repair gene, has significant implications for research and experimental design. The "C" in YMR166C indicates that the gene is encoded on the Crick (complementary) strand, running in the opposite direction to the Watson strand.

When studying YMR166C, it's important to consider this genomic context, as manipulations of YMR166C may inadvertently affect MLH1 expression. Researchers should implement proper controls when designing knockout or mutation experiments to distinguish between direct effects of YMR166C manipulation and indirect effects caused by altered MLH1 function.

What protein family does YMR166C belong to and what are its defining characteristics?

YMR166C belongs to the mitochondrial carrier family (MCF), a group of proteins characterized by three tandem repeats of approximately 100 amino acids, each containing two transmembrane α-helices linked by a large loop . Based on sequence analysis and comparative modeling, YMR166C displays specific signatures that place it in the amino acid carrier subgroup of mitochondrial transporters .

Key characteristics of YMR166C include:

  • Three contact points typical of mitochondrial carriers: G-S-F at contact point I, R-D at contact point II, and W at contact point III

  • Features consistent with amino acid transport function

  • Substitution of serine for the typical proline in its sequence motif (S73)

This classification provides a starting point for experimental design, suggesting that researchers should focus on amino acid transport assays when investigating YMR166C function.

Why is YMR166C considered "uncharacterized" and what does this mean for research approaches?

YMR166C is considered "uncharacterized" because its specific substrate and precise biological function have not been definitively established through direct experimental validation . While sequence analysis suggests it functions as an amino acid carrier, transport assays with purified reconstituted protein—the gold standard for characterization—have not been reported in the literature.

This uncharacterized status necessitates a methodological approach that combines:

  • Comparative sequence analysis and structural modeling based on characterized family members

  • Genetic approaches (knockouts, conditional mutants)

  • Biochemical assays testing multiple potential substrates

  • Localization studies to confirm mitochondrial targeting

  • Phenotypic analyses under various stress conditions

When researching uncharacterized proteins, it's advisable to implement multiple complementary approaches rather than relying on a single experimental paradigm, as each method carries inherent limitations and biases.

How does the proximity of YMR166C to MLH1 affect experimental design and data interpretation?

The genomic arrangement where YMR166C is located 413 bp from MLH1 on the opposite strand creates significant experimental challenges . This proximity means that the promoter regions may overlap, creating potential regulatory interdependence between these genes.

Methodological considerations for addressing this challenge include:

When interpreting phenotypic data from YMR166C mutants, researchers should always consider whether effects are direct or result from altered MLH1 function, particularly when observing mutator phenotypes.

What computational methods can predict the substrate specificity of YMR166C?

Predicting substrate specificity for uncharacterized mitochondrial carriers like YMR166C requires sophisticated computational approaches:

  • Comparative modeling based on structurally characterized family members:

    • Using the bovine ADP/ATP carrier (BtAAC1) as a template for homology modeling

    • Identifying conserved residues in transmembrane regions that may contribute to substrate binding

  • Contact point analysis:
    YMR166C exhibits the following contact points characteristic of amino acid carriers:

    Contact PointYMR166C ResiduesTypical for Carriers of
    IG-S-FAmino acids
    IIR-DAmino acids
    IIIWAmino acids

    These contact points are consistent with other characterized amino acid transporters such as Agc1p, Pet8p, and Ort1p .

  • Molecular docking simulations:

    • Virtual screening of potential substrates against the modeled binding pocket

    • Molecular dynamics simulations to evaluate binding stability

  • Machine learning approaches:

    • Training algorithms on known carrier-substrate pairs

    • Applying these to predict YMR166C substrates based on sequence features

The methodological approach should integrate multiple computational predictions with experimental validation through biochemical assays testing the highest-probability candidate substrates.

How might YMR166C function relate to mitochondrial metabolism and cellular homeostasis?

Based on its classification as a potential amino acid carrier, YMR166C may play critical roles in:

  • Amino acid transport between cytosol and mitochondria:

    • Supporting protein synthesis within mitochondria

    • Facilitating amino acid catabolism for energy production

    • Contributing to nitrogen metabolism

  • Redox balance:

    • Potentially transporting amino acids involved in glutathione synthesis

    • Supporting mitochondrial antioxidant systems

  • Metabolic integration:

    • Connecting cytosolic and mitochondrial amino acid pools

    • Supporting gluconeogenesis from amino acid precursors

Research approaches to investigate these possibilities include:

  • Metabolomic profiling of YMR166C mutants

  • Isotope labeling experiments to track amino acid flux

  • Growth analyses under various nutrient conditions

  • Synthetic lethality screens with mutants in related metabolic pathways

When designing these experiments, researchers should carefully control for potential MLH1 effects and implement appropriate complementation controls to ensure observed phenotypes are directly attributable to YMR166C function.

What are the most effective approaches for confirming the substrate specificity of YMR166C?

Confirming substrate specificity for YMR166C requires a multi-layered methodological approach:

  • Reconstitution transport assays (gold standard):

    • Express and purify recombinant YMR166C protein

    • Reconstitute into liposomes

    • Test transport of radiolabeled potential substrates

    • Measure kinetic parameters (Km, Vmax) for various amino acids

  • Genetic complementation in yeast:

    • Identify yeast strains with known defects in specific amino acid transport

    • Express YMR166C and assess restoration of growth phenotypes

    • Compare with established carriers with known substrates

  • Mitochondrial uptake experiments:

    • Isolate intact mitochondria from wild-type and YMR166C-deleted strains

    • Measure differential uptake of labeled amino acids

    • Perform competition assays to determine specificity

  • Structural biology approaches:

    • Attempt co-crystallization with potential substrates

    • Use cryo-EM to visualize substrate binding

When implementing these methods, researchers should:

  • Include positive controls using characterized carriers

  • Test multiple potential substrates based on the R-D contact point that suggests amino acid specificity

  • Consider the possibility of substrate promiscuity, as some mitochondrial carriers transport multiple related compounds

How can researchers distinguish between direct effects of YMR166C deletion and indirect effects due to MLH1 disruption?

Distinguishing between direct YMR166C effects and indirect MLH1 effects requires sophisticated experimental design:

  • Complementation strategy:

    • Create a YMR166C deletion strain

    • Transform with plasmids expressing:
      a) YMR166C alone
      b) MLH1 alone
      c) Both genes
      d) Empty vector control

    • Compare phenotypic rescue patterns

  • Point mutation approach:

    • Introduce nonsense or missense mutations in YMR166C that don't affect the MLH1 promoter region

    • Compare phenotypes with complete deletion mutants

  • Conditional expression systems:

    • Implement tetracycline-repressible or galactose-inducible YMR166C constructs

    • Observe acute effects of YMR166C depletion before secondary MLH1 effects manifest

  • Separable function analysis:

    • Screen for mutations that affect one function but not the other

    • Identify separation-of-function alleles that can help distinguish phenotypes

  • Epistasis analysis:

    • Compare single and double mutants of YMR166C and MLH1

    • Analyze whether phenotypes are additive or identical

Previous research has demonstrated that MLH1 plasmid complementation largely corrects the mutator phenotype of YMR166C deletion mutants , suggesting that many observed phenotypes may be due to MLH1 disruption rather than direct YMR166C functions.

What cellular phenotyping approaches are most informative for studying YMR166C function?

Given YMR166C's potential role as a mitochondrial amino acid carrier, several phenotyping approaches are particularly informative:

  • Respiratory capacity analysis:

    • Measure oxygen consumption rates

    • Assess growth on non-fermentable carbon sources

    • Evaluate respiratory chain complex activities

  • Mitochondrial morphology and dynamics:

    • Fluorescence microscopy of mitochondrially-targeted proteins

    • Analysis of fusion/fission dynamics

    • Assessment of mitochondrial membrane potential

  • Stress response phenotyping:

    • Oxidative stress sensitivity (H₂O₂, paraquat)

    • Amino acid starvation response

    • Temperature sensitivity

  • Metabolic profiling:

    • Intracellular amino acid levels

    • TCA cycle intermediates

    • ATP/ADP ratios

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis

    • Quantitative assessment of genetic interactions with other mitochondrial transporters

    • Epistasis analysis with amino acid metabolism genes

When interpreting phenotypic data, researchers should consider that mitochondrial carrier deletions often produce subtle phenotypes under standard laboratory conditions but may show pronounced effects under specific stress or nutrient conditions that depend on the transported substrate.

How should researchers integrate structural modeling with experimental data to characterize YMR166C?

Integrating structural modeling with experimental data requires a systematic approach:

  • Initial homology modeling:

    • Use the bovine ADP/ATP carrier (BtAAC1) structure as a template

    • Identify contact points and potential substrate binding residues

    • Generate hypotheses about substrate specificity

  • Experimental validation cycle:

    • Test predictions through mutagenesis of key residues

    • Perform transport assays with predicted substrates

    • Use results to refine the structural model

  • Integration methods:

    • Bayesian approaches to update structural models based on experimental probabilities

    • Molecular dynamics simulations constrained by experimental data

    • Machine learning models that incorporate both sequence features and experimental results

The structural information from search result suggests that YMR166C has three key contact points (G-S-F, R-D, W) that align with amino acid carriers. Additionally, YMR166C has a serine substitution (S73) where most family members have proline . Researchers should specifically investigate how this substitution affects protein conformation and substrate specificity through targeted mutagenesis and functional assays.

What are the most relevant comparative analyses for understanding YMR166C function?

Comparative analyses provide critical context for understanding YMR166C:

  • Phylogenetic analysis:

    • Compare YMR166C sequences across fungal species

    • Identify co-evolution with metabolic pathways

    • Map evolutionary conservation of key residues

  • Comparative expression analysis:

    • Analyze co-expression patterns with other mitochondrial transporters

    • Identify conditions that specifically upregulate YMR166C

    • Compare with expression profiles of known amino acid carriers

  • Cross-species functional complementation:

    • Test whether YMR166C can rescue phenotypes of carrier mutants in other species

    • Examine whether mammalian homologs can complement YMR166C deletion in yeast

  • Comparative substrate specificity:

    • Create a comparison table of contact point residues and known substrates:

    CarrierContact Point IContact Point IIContact Point IIIKnown Substrate
    YMR166CG-S-FR-DWUnknown
    Pet8pA-G-FR-EWS-adenosylmethionine
    Ort1pG-E-LR-EROrnithine
    Agc1pG-E-KR-DRGlutamate

This comparative data from the search results suggests that YMR166C shares features with Pet8p (the S-adenosylmethionine carrier), particularly the tryptophan residue at contact point III, which might provide clues to its substrate specificity.

How can researchers resolve contradictory data regarding YMR166C function?

When facing contradictory data about YMR166C function, researchers should employ the following methodological approaches:

  • Source analysis:

    • Evaluate methodological differences between contradictory studies

    • Assess genetic background variations in yeast strains used

    • Consider differences in growth conditions and assay sensitivities

  • Replication with controlled variables:

    • Systematically test each contradictory finding while controlling for:
      a) Strain background effects
      b) MLH1 expression levels
      c) Mitochondrial genome status (rho+ vs. rho-)
      d) Media composition and growth phase

  • Integration approaches:

    • Develop mathematical models that can accommodate seemingly contradictory data

    • Use Bayesian network analysis to identify conditional dependencies

    • Implement meta-analysis techniques for quantitative comparison of different studies

  • Resolution through additional variables:

    • Consider that YMR166C may have multiple functions or substrates

    • Investigate condition-dependent roles

    • Examine post-translational modifications that might switch functions

What emerging technologies could accelerate the functional characterization of YMR166C?

Several cutting-edge technologies offer promising approaches for YMR166C characterization:

  • CRISPR-based methods:

    • CRISPRi for tunable gene repression without genomic disruption

    • Base editing for introducing point mutations without double-strand breaks

    • Prime editing for precise modifications that preserve genomic context

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize YMR166C localization within mitochondrial subcompartments

    • FRET sensors to detect substrate binding in real-time

    • Live-cell imaging with conditionally fluorescent amino acids

  • High-throughput functional assays:

    • Transporter-substrate trap approaches

    • Metabolomics coupled with machine learning for substrate prediction

    • Massively parallel reporter assays for regulatory element mapping

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-to-cell variation in YMR166C expression

    • Single-cell metabolomics to detect substrate changes

    • Microfluidic approaches for real-time monitoring of single-cell phenotypes

  • Structural biology advances:

    • Cryo-EM techniques optimized for membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • AlphaFold2 and similar AI-based structure prediction tools calibrated with experimental data

These technologies can help overcome the specific challenges posed by YMR166C's proximity to MLH1 and its uncharacterized status by providing more precise, high-resolution data than conventional approaches.

How might studying YMR166C contribute to broader understanding of mitochondrial carrier evolution and function?

Research on YMR166C has significant implications for understanding mitochondrial carrier evolution:

  • Evolutionary insights:

    • YMR166C may represent a specialized adaptation in yeast metabolism

    • Comparing YMR166C with carriers in other species could reveal evolutionary trajectories of substrate specificity

    • Analysis of selection pressures on different carrier residues may identify functionally critical regions

  • Structure-function relationships:

    • The unusual serine substitution (S73) where most carriers have proline provides an opportunity to study how such variations affect carrier conformation

    • Comparative analysis of YMR166C's G-S-F/R-D/W contact points with other carriers can clarify the molecular basis of substrate recognition

  • Integrated mitochondrial function:

    • Understanding YMR166C's role may reveal novel connections between amino acid metabolism and other mitochondrial processes

    • Studying its regulation could uncover new mechanisms of coordinating nuclear and mitochondrial gene expression

  • Methodological advances:

    • Developing approaches to study YMR166C despite its proximity to MLH1 may yield broadly applicable techniques for studying genes in complex genomic contexts

    • Computational approaches refined on YMR166C could improve predictive models for other uncharacterized carriers

A methodological framework for this research would include comparative genomics across species, ancestral sequence reconstruction, and experimental testing of evolutionary hypotheses through synthetic biology approaches.

What interdisciplinary approaches might yield breakthrough insights about YMR166C?

Breakthrough insights often emerge at the intersection of disciplines:

  • Systems biology and mathematical modeling:

    • Flux balance analysis incorporating YMR166C transport

    • Whole-cell modeling to predict phenotypic consequences of YMR166C manipulation

    • Network analysis to identify functional modules involving YMR166C

  • Chemical biology approaches:

    • Development of specific inhibitors for YMR166C

    • Activity-based protein profiling to identify interacting molecules

    • Chemogenetic strategies for acute and selective YMR166C regulation

  • Synthetic biology:

    • Engineering synthetic circuits involving YMR166C to study its regulation

    • Creating minimal mitochondrial carrier systems to isolate and study function

    • Designed protein scaffolds to control YMR166C interactions

  • Translational connections:

    • Examining human homologs of YMR166C for disease associations

    • Investigating whether YMR166C function relates to mitochondrial disorders

    • Exploring potential therapeutic implications of modulating related carriers

A methodological framework for interdisciplinary research would include establishing collaborative teams with diverse expertise, developing common experimental systems accessible to different disciplines, and creating integrated data analysis pipelines that can synthesize heterogeneous data types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.