Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial membrane protein FMP10 (FMP10)

Shipped with Ice Packs
In Stock

Description

Introduction

Saccharomyces cerevisiae, commonly known as baker's yeast, is a widely utilized eukaryotic expression system, especially for mitochondrial membrane proteins . Its ease of growth and inherent ability to correctly target proteins to the mitochondria make it suitable for producing complex proteins . Within the mitochondria of S. cerevisiae exists a multitude of proteins, a portion of which remain functionally uncharacterized . Among these is the uncharacterized mitochondrial membrane protein FMP10.

Overview of FMP10

FMP10 is an uncharacterized protein located in the mitochondrial membrane of Saccharomyces cerevisiae . The "FMP" designation stands for "Functionally Mysterious Protein," highlighting its unknown function . To date, research on FMP10 is limited, and its precise role within the mitochondria remains elusive.

Role of Saccharomyces cerevisiae in Protein Expression

Saccharomyces cerevisiae serves as an effective host for expressing mitochondrial membrane proteins due to several key advantages:

  • Ease of Use: S. cerevisiae is simple to culture and genetically manipulate, making it a favorite for recombinant protein production .

  • Native Environment: Expressing mitochondrial proteins in yeast allows them to be targeted to their native environment, potentially improving folding and stability .

  • Post-translational Modifications: S. cerevisiae can perform eukaryotic post-translational modifications, which are essential for the function of many proteins .

  • Co-expression: The yeast system can co-express multiple proteins, which is useful for producing multi-subunit protein complexes .

Mitochondrial Protein Expression and Purification

To produce recombinant FMP10, the gene encoding the protein is introduced into S. cerevisiae cells. Various strategies can optimize expression:

  • Promoter Systems: Different promoters can be used to control the level of protein expression .

  • Codon Optimization: Optimizing the codon sequence of the FMP10 gene can improve translation efficiency in yeast .

  • Complementation Strategies: Complementation strategies can be employed to ensure proper protein folding and function .

After expression, the mitochondria are isolated from the yeast cells through differential centrifugation, which provides an enriched membrane fraction . The recombinant FMP10 protein can then be purified using affinity chromatography. A common approach involves using specific proteolytic cleavage to release the protein from the affinity column, which enhances sample purity by leaving contaminants bound to the column .

Mitochondrial Protein Degradation System

Mitochondria possess a protein degradation system that maintains their health as yeast cells grow . Mitochondrial membrane fission is essential for releasing mitochondrial-derived compartments (MDCs) for autophagic degradation . Additionally, Tom70 and Tom71 are required for the formation of MDCs and the subsequent breakdown of mitochondrial proteins within them .

Potential Functions and Future Research Directions

Although FMP10 is currently uncharacterized, its presence in the mitochondrial membrane suggests potential roles in:

  • Mitochondrial dynamics: Participating in membrane remodeling, fission, or fusion processes.

  • Protein transport: Assisting in the import or export of proteins across the mitochondrial membrane.

  • Metabolic processes: Involvement in metabolic pathways occurring within the mitochondria.

  • Stress response: Protecting mitochondria against membrane potential loss .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FMP10; YER182W; Uncharacterized mitochondrial membrane protein FMP10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FMP10
Target Protein Sequence
MFKRIAIAQIRTYTNGVVFKTASKPKRRWIPWTIFGGSFLGGWYLTQHMTFTDLLAYWRY DALPKNADEVVKYHADLNRRLNGLPIVKQLENAGFVQVIANEEENLLVSRALNTPGGVAI PPRVYYNPSRRETVGLYHLGMKLTGYPFLIHGGILATVIEDLMKEAIRLEKGTKNINQET KNLSISYKFPTLANQFVVVRTTDLQQYGNKTKLKAELMDQSGNRTLVKANATFSSEQGNP KEEK
Uniprot No.

Target Background

Database Links

KEGG: sce:YER182W

STRING: 4932.YER182W

Protein Families
FMP10 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How can researchers express and purify recombinant FMP10 protein?

Recombinant FMP10 protein can be successfully expressed in E. coli expression systems with an N-terminal His-tag. The methodology involves:

  • Cloning: The full-length FMP10 gene (positions 1-244) should be PCR-amplified from S. cerevisiae genomic DNA and inserted into an expression vector containing an N-terminal His-tag.

  • Expression: Transform the construct into E. coli and induce protein expression under optimal conditions (typically IPTG induction for T7-based systems).

  • Purification protocol:

    • Harvest cells and lyse using appropriate buffer systems

    • Purify using immobilized metal affinity chromatography (IMAC)

    • Elute with imidazole-containing buffers

    • Confirm purity via SDS-PAGE (>90% purity is achievable)

  • Storage: Store the purified protein as a lyophilized powder, or reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol and store at -20°C/-80°C. Avoid repeated freeze-thaw cycles as they can affect protein stability .

What genetic databases and resources are available for FMP10 research?

Several comprehensive databases provide valuable information for FMP10 research:

Database/ResourceAvailable InformationAccess Method
Saccharomyces Genome Database (SGD)Gene sequence, annotations, related literatureDirect access via locus ID S000000984
BioGRID197 protein interactors, 222 interactions, and 1 PTM siteAccessible through BioGRID ID 36936
GenScriptcDNA ORF clone information, orthologuesAvailable through Entrez Gene ID 856931
NCBI/PubMedResearch publications on FMP10Literature databases with relevant search terms

Researchers should utilize these resources for comprehensive information gathering before designing experiments, as they provide valuable insights into potential protein functions through interaction networks and comparative genomics.

What is the role of FMP10 in biofilm formation and how does it relate to FLO11 induction?

FMP10 has been identified as one of 71 genes essential for biofilm development in Saccharomyces cerevisiae. Quantitative Northern blot analysis has revealed that FMP10 controls biofilm formation through the induction of FLO11, a key flocculin gene involved in cell-cell adhesion .

The functional relationship appears to operate in three interconnected phenotypes:

PhenotypeEffect of FMP10 DeletionRelationship to Other Phenotypes
Biofilm formation in liquid mediumCompletely abolishedPrimary effect
Surface-spreading biofilm colonies (mats)Lost abilityAlmost all biofilm-defective mutants also lose mat formation
Invasive growthFrequently lost69% of biofilm-defective mutants also lose invasive growth

The regulatory pathway likely involves complex transcriptional and post-transcriptional control mechanisms. While the exact molecular mechanism remains to be fully characterized, FMP10 appears to work in concert with other genes like AIM1, ASG1, AVT1, and others to regulate FLO11 expression. For researchers investigating this pathway, analysis of protein-protein interactions between FMP10 and components of transcriptional complexes would be a productive avenue for further research .

How do mitochondrial localization and function of FMP10 relate to its role in biofilm development?

This question addresses an intriguing paradox in FMP10 research: how a mitochondrial membrane protein influences biofilm formation, which is primarily regulated by cell surface and signaling components. Current research suggests several hypothetical mechanisms that warrant investigation:

  • Energy metabolism regulation: FMP10 may influence mitochondrial energy production that supports the metabolic requirements for biofilm formation.

  • Retrograde signaling: As a mitochondrial protein, FMP10 could participate in mitochondria-to-nucleus retrograde signaling pathways that ultimately affect nuclear gene expression, including FLO11.

  • Metabolic sensing: FMP10 might function as a sensor for metabolic conditions conducive to biofilm formation, relaying signals to transcriptional machinery.

Methodologically, researchers should approach this question through:

  • Subcellular fractionation studies confirming the exclusive mitochondrial localization of FMP10

  • Comparative metabolomics between wild-type and FMP10 deletion strains

  • Analysis of mitochondrial function parameters (membrane potential, ATP production) in relation to biofilm competence

  • ChIP-seq analysis to identify potential regulatory interactions between FMP10 and nuclear factors

What are the evolutionary implications of FMP10's role across different yeast species?

FMP10 orthologues have been identified in related yeast species, suggesting evolutionary conservation of function. Comparative analysis reveals:

SpeciesGene/Protein IDEvidence of Conservation
Saccharomyces cerevisiaeFMP10 (NP_011109.3)Reference sequence
Kluyveromyces lactisKLLA0A10263g (XP_451449.1)Orthologous protein
Eremothecium gossypiiAGOS_ADL386W (NP_983710.1)Orthologous protein

To investigate evolutionary implications, researchers should:

  • Perform phylogenetic analysis of FMP10 across multiple yeast species to determine conservation patterns and evolutionary rates

  • Conduct complementation studies by expressing FMP10 orthologues from different species in S. cerevisiae FMP10 deletion strains to assess functional conservation

  • Analyze the regulatory regions of FMP10 across species to identify conserved regulatory elements

  • Examine whether the relationship between FMP10 and biofilm formation is conserved in other species that form biofilms

This evolutionary approach can provide insight into the fundamental importance of FMP10 function and potentially identify species-specific adaptations.

Deletion Analysis:

FMP10 deletion studies should employ precise gene replacement strategies to ensure specific phenotypic analysis:

  • Deletion construction: Use PCR-based gene deletion with selectable markers. The comprehensive deletion mutant collection in the Σ1278b background has been successfully used for biofilm studies .

  • Phenotypic assays:

    • Biofilm formation: Culture cells in liquid medium with appropriate solid surfaces for attachment; quantify biofilm formation through crystal violet staining and spectrophotometric measurement

    • Mat formation: Plate cells on specialized low-agar medium (0.3% agar) and observe colony spreading after 5-7 days of growth

    • Invasive growth: Standard plate-washing assay after growth on YPD plates for 3-5 days

  • Complementation: Reintroduce wild-type FMP10 on a plasmid to confirm phenotype rescue and rule out secondary mutations

Overexpression Analysis:

  • Expression construct: Place FMP10 under a strong inducible promoter (GAL1) with appropriate tagging for detection (HA or GFP)

  • Induction protocol: Transform into wild-type strains and induce with galactose; monitor expression levels via Western blot

  • Phenotypic assessment: Evaluate effects on:

    • Growth rates in different media conditions

    • Biofilm formation capacity

    • FLO11 expression levels via quantitative Northern blot

    • Mitochondrial morphology and function

What techniques are most effective for analyzing FMP10 protein interactions and complexes?

FMP10 protein interactions can be effectively studied using complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express His-tagged FMP10 in S. cerevisiae

    • Isolate mitochondria using differential centrifugation

    • Solubilize membrane proteins with mild detergents (digitonin or DDM)

    • Purify complexes using nickel affinity chromatography

    • Identify interacting partners via LC-MS/MS

  • Proximity-dependent biotin identification (BioID):

    • Generate FMP10-BirA* fusion protein

    • Express in yeast and provide biotin

    • Isolate biotinylated proteins for identification

    • This method is particularly useful for transient interactions

  • Yeast two-hybrid screening:

    • While challenging for membrane proteins, modified membrane Y2H systems can be employed

    • Screen against genomic or cDNA libraries to identify interactors

    • Validate interactions using orthogonal methods

  • Co-immunoprecipitation validation:

    • Generate antibodies against FMP10 or use epitope-tagged versions

    • Perform reciprocal co-IP experiments with potential interactors

    • Western blot analysis to confirm interactions

The BioGRID database already indicates 197 potential protein interactors for FMP10, which provides a starting point for targeted validation experiments .

How should researchers interpret transcriptomic data related to FMP10 in biofilm studies?

When analyzing transcriptomic data in FMP10-related biofilm studies, researchers should employ the following methodological approach:

  • Experimental design considerations:

    • Include appropriate time points during biofilm development (early, middle, and mature phases)

    • Compare wild-type, FMP10 deletion, and FMP10 overexpression strains

    • Include planktonic cells as controls to distinguish biofilm-specific effects

  • Data normalization and filtering:

    • Use appropriate normalization methods for RNA-seq or microarray data

    • Filter low-expression genes to reduce noise

    • Apply batch correction if necessary

  • Differential expression analysis:

    • Focus on genes associated with cell adhesion, particularly FLO11

    • Examine mitochondrial gene expression patterns

    • Look for co-regulated gene clusters that might indicate functional pathways

  • Integration with known biofilm regulation:

    • Compare with the 37 genes known to control biofilm through FLO11 induction (AIM1, ASG1, AVT1, DRN1, ELP4, FLO8, etc.)

    • Analyze protein kinase A pathway components, particularly related to Tpk3p function

    • Look for connections to transcriptional regulators like Tec1p

  • Validation strategy:

    • Confirm key expression changes via quantitative Northern blot or qRT-PCR

    • Test functional relationships through epistasis analysis

    • Correlate gene expression with phenotypic outcomes

This systematic approach will help identify whether FMP10 functions primarily at the transcriptional, post-transcriptional, or post-translational level in regulating biofilm formation.

What are the appropriate controls and statistical analyses for FMP10 functional studies?

Robust experimental design for FMP10 functional studies requires:

Control TypePurposeImplementation
Genetic controlsAccount for strain background effectsInclude wild-type, FMP10 deletion, and complemented strains in the same background
Environmental controlsControl for media and growth conditionsStandardize media composition, temperature, and growth phase
Technical controlsMinimize procedural variabilityInclude technical replicates and standardized protocols

Statistical analysis recommendations:

  • Sample size determination:

    • Minimum of 3 biological replicates for each condition

    • Power analysis to determine appropriate sample size for expected effect magnitude

  • Statistical methods:

    • ANOVA with post-hoc tests for multi-condition comparisons

    • FDR correction for multiple hypothesis testing in -omics studies

    • Non-parametric tests when normality cannot be assumed

  • Validation strategies:

    • Cross-validation of findings with alternative methods

    • Genetic epistasis analysis to confirm pathway relationships

    • Phenotypic rescue experiments with controlled expression levels

  • Data presentation:

    • Include both raw data and normalized results

    • Provide clear indication of variability (standard deviation or standard error)

    • Use appropriate visualization methods for complex datasets

What are the most promising research avenues for understanding FMP10 function in cellular metabolism?

Given the current understanding of FMP10, several high-priority research directions emerge:

  • Structural biology approaches:

    • Determine the three-dimensional structure of FMP10 through X-ray crystallography or cryo-EM

    • Identify functional domains and potential binding sites

    • Perform structure-function relationship studies with targeted mutations

  • Integration with mitochondrial biology:

    • Investigate the role of FMP10 in mitochondrial membrane organization

    • Determine effects on mitochondrial respiration and energy production

    • Explore potential roles in mitochondrial protein import or quality control

  • Systems biology approaches:

    • Perform metabolomic analysis of FMP10 mutants under biofilm and non-biofilm conditions

    • Integrate transcriptomic, proteomic, and metabolomic data to build comprehensive pathway models

    • Utilize computational modeling to predict functional relationships

  • Translational research potential:

    • Explore whether targeting FMP10 or its pathway could serve as an anti-biofilm strategy

    • Investigate conservation of function in pathogenic yeast species

    • Develop small molecule modulators of FMP10 function for research tools

These research directions require interdisciplinary approaches and could significantly advance our understanding of both mitochondrial biology and biofilm regulation in yeast.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.