Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial outer membrane protein YDR381C-A (YDR381C-A)

Shipped with Ice Packs
In Stock

Description

Reconstitution and Handling

For optimal use in laboratory settings, the lyophilized protein requires proper reconstitution. Manufacturers recommend centrifuging the vial briefly before opening to ensure all material is collected at the bottom. The protein should be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . To enhance stability, addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard manufacturer recommendation for long-term storage applications .

Research Applications and Tools

While the specific function of YDR381C-A remains to be fully elucidated, research tools have been developed to facilitate its study, including antibodies and expression systems. These tools enable investigations into protein localization, expression patterns, and potential roles in cellular processes.

Antibodies and Detection Methods

Polyclonal antibodies against YDR381C-A are commercially available, typically raised in rabbits using the recombinant protein as the immunogen . These antibodies have been validated for applications including Western blotting and ELISA, providing researchers with tools to detect and quantify the native protein in yeast samples . The antibodies are generally supplied in liquid form with glycerol and preservatives to maintain stability during storage at -20°C or -80°C .

Table 2: YDR381C-A Antibody Specifications

CharacteristicSpecification
HostRabbit
TypePolyclonal
ApplicationsELISA, Western Blot
ReactivitySaccharomyces cerevisiae (strain ATCC 204508 / S288c)
FormLiquid
PurificationAntigen Affinity Purified
Storage Buffer50% Glycerol, 0.01M PBS, pH 7.4, 0.03% Proclin 300
Storage-20°C or -80°C

ELISA Kits

Enzyme-linked immunosorbent assay (ELISA) kits for YDR381C-A are available for quantitative detection of the protein in research applications . These kits utilize the specificity of antibodies directed against YDR381C-A to provide sensitive and reliable measurements of protein levels in experimental samples.

Potential Functional Roles

Despite its "uncharacterized" status, several lines of evidence suggest potential functional associations for YDR381C-A. Its localization to the mitochondrial outer membrane positions it as a potential participant in mitochondrial processes, including protein import, membrane organization, or signaling pathways.

RNA-Binding Protein Interactions

Recent multi-omic studies have investigated the interactions between various mitochondrial proteins and RNA-binding proteins. While not directly focusing on YDR381C-A, these studies have revealed networks of interactions that help coordinate mitochondrial function with cellular metabolism . The integration of transcriptomic, proteomic, and metabolomic data has identified high-confidence targets of RNA-binding proteins involved in mitochondrial processes, providing a framework for understanding how proteins like YDR381C-A might be regulated .

Recombinant Yeast as Experimental Systems

Recombinant Saccharomyces cerevisiae has been utilized as a vehicle for delivering antigens in vaccine immunotherapy protocols, highlighting the utility of yeast-based expression systems in both research and potential therapeutic applications . While these studies do not specifically focus on YDR381C-A, they demonstrate how recombinant yeast proteins can be employed in diverse experimental contexts, suggesting potential applications for YDR381C-A in future research .

Future Research Directions

The uncharacterized nature of YDR381C-A presents numerous opportunities for future research. Several promising directions include:

  1. Functional characterization studies to determine its precise role in mitochondrial biology

  2. Interaction studies to identify binding partners and regulatory networks

  3. Structural analyses to resolve three-dimensional conformation and functional domains

  4. Comparative analyses across different yeast species to understand evolutionary conservation

  5. Gene knockout or silencing studies to assess phenotypic consequences of YDR381C-A deficiency

The availability of recombinant protein, antibodies, and detection kits provides researchers with the tools necessary to pursue these investigations, potentially uncovering new insights into mitochondrial membrane organization and function.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
YDR381C-A; Uncharacterized mitochondrial outer membrane protein YDR381C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR381C-A
Target Protein Sequence
MSNPFQNIGKNLLYISAAGIASIYVVKTIVKARRDAKFIPKARGNNGEVNEKNYYDNLAQ VKPGFPIPKDGGDNIDCSEDHQLVRKSKYEGSGLSAVTRKRGDKLGFLDRRRNE
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is YDR381C-A and why has it been renamed to COI1?

YDR381C-A is an uncharacterized mitochondrial protein from Saccharomyces cerevisiae that was recently identified as an important assembly factor for respiratory chain complex III, complex IV, and their supercomplexes. The protein was renamed as Cox interacting protein 1 (COI1) due to its demonstrated physical interactions with subunits of these respiratory complexes . This 12.7 kDa protein has no known homologues in higher eukaryotes and contains a putative transmembrane segment in its N-terminal region (amino acid residues 11-30) .

What are the recommended methods for expressing and purifying recombinant YDR381C-A protein for experimental studies?

For recombinant expression, the full-length YDR381C-A protein (amino acids 1-114) can be expressed in E. coli with an N-terminal His-tag to facilitate purification . The protein should be purified using affinity chromatography under conditions that maintain its native conformation. To preserve stability, the purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being optimal) and store aliquots at -20°C/-80°C to prevent degradation through repeated freeze-thaw cycles .

When reconstituting the lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL after briefly centrifuging the vial to ensure all contents settle at the bottom . The purity should be greater than 90% as determined by SDS-PAGE analysis.

How should researchers design experiments to study the function of YDR381C-A/COI1 in mitochondrial respiration?

When designing experiments to study YDR381C-A/COI1 function in mitochondrial respiration, researchers should follow a systematic experimental design approach :

  • Define variables precisely:

    • Independent variable: Presence/absence of YDR381C-A/COI1 (using knockout strains)

    • Dependent variables: Respiratory growth, membrane potential, respiration rate, complex III/IV assembly

    • Control variables: Growth conditions, temperature, carbon source

  • Formulate a specific, testable hypothesis based on the known involvement of YDR381C-A/COI1 in respiratory chain assembly .

  • Design comparative treatments:

    • Wild-type strains vs. coi1Δ deletion mutants

    • Complementation with functional vs. mutated COI1 variants

    • Conditional expression systems for time-dependent analysis

  • Implement appropriate controls to account for potential confounding factors such as growth phase, metabolic state, and mitochondrial integrity.

  • Employ multiple measurement techniques to assess respiratory function, including oxygen consumption assays, membrane potential measurements, and biochemical analyses of respiratory complex assembly and activity.

How does YDR381C-A/COI1 interact with complexes III and IV of the respiratory chain?

YDR381C-A/COI1 has been identified as an assembly factor that interacts with subunits of both respiratory chain complex III and complex IV . The interaction appears to be transient rather than permanent, as COI1 is not a stoichiometric subunit of either complex. Key findings regarding these interactions include:

  • Physical associations with Cox4, a subunit of complex IV, have been documented in interactome studies .

  • Deletion of COI1 results in reduced steady-state levels of subunits of both complexes III and IV, suggesting a role in stabilizing these complexes during assembly .

  • The protein likely functions as a scaffold or chaperone during the assembly process, facilitating the formation of individual complexes and their organization into supercomplexes.

Investigation of these interactions requires techniques such as co-immunoprecipitation, crosslinking studies, or proximity labeling approaches to capture the transient nature of COI1's involvement in complex assembly.

What techniques are most effective for analyzing protein-protein interactions of YDR381C-A/COI1 with respiratory chain components?

For analyzing YDR381C-A/COI1 interactions with respiratory chain components, several complementary approaches should be employed:

  • Co-immunoprecipitation with epitope-tagged COI1: This allows identification of stable interaction partners and can be coupled with mass spectrometry for unbiased identification of the interactome.

  • Crosslinking mass spectrometry: Since interactions may be transient, chemical crosslinking followed by mass spectrometry analysis can capture fleeting interactions during the assembly process.

  • BioID or APEX proximity labeling: These methods allow identification of proteins in close proximity to COI1 in vivo by expressing COI1 fused to a biotin ligase or peroxidase.

  • Blue Native PAGE: This technique preserves protein complexes in their native state and can reveal how COI1 deletion affects the assembly and stability of respiratory supercomplexes.

  • Förster Resonance Energy Transfer (FRET): When combined with fluorescently-tagged proteins, FRET can detect direct interactions between COI1 and respiratory chain components in intact mitochondria.

BioGRID database indicates that YDR381C-A/COI1 has 59 identified interactors with 62 documented interactions , providing a rich dataset for targeted validation studies.

What are the key phenotypic effects of YDR381C-A/COI1 deletion in yeast cells?

Deletion of the COI1 gene (coi1Δ) results in several significant phenotypic effects:

  • Decreased respiratory growth: Cells lacking COI1 show impaired growth on non-fermentable carbon sources, indicating compromised mitochondrial respiration .

  • Reduced mitochondrial membrane potential: The electrochemical gradient across the inner mitochondrial membrane is diminished in coi1Δ cells, affecting various mitochondrial functions .

  • Hampered respiration: Oxygen consumption rates are decreased, reflecting impaired electron transport chain function .

  • Temperature sensitivity: The mutant exhibits slow fermentative growth particularly at low temperatures, suggesting a role in adaptation to environmental stress .

  • Reduced levels of respiratory complexes: Both individual respiratory complexes III and IV and their supercomplexes show decreased steady-state levels in the absence of COI1 .

These phenotypic effects collectively indicate that while COI1 is not essential for viability under fermentative conditions, it plays a critical role in maintaining efficient respiratory metabolism in yeast.

How should researchers design complementation studies to verify the function of YDR381C-A/COI1?

To rigorously verify YDR381C-A/COI1 function through complementation studies, researchers should:

  • Generate a complete gene deletion strain: Create a coi1Δ strain with the entire open reading frame removed to eliminate any partial protein expression.

  • Prepare multiple complementation constructs:

    • Wild-type COI1 under its native promoter

    • COI1 with site-specific mutations in the transmembrane domain (aa 11-30)

    • COI1 with mutations in conserved residues

    • COI1 with epitope tags for localization and interaction studies

  • Use appropriate expression vectors: Employ low-copy centromeric plasmids for near-physiological expression levels and high-copy plasmids to assess overexpression effects.

  • Assess multiple phenotypic parameters:

    • Growth rates on fermentable and non-fermentable carbon sources

    • Respiratory complex assembly using Blue Native PAGE

    • Oxygen consumption rates

    • Mitochondrial membrane potential

    • Supercomplex formation

  • Implement quantitative measurements: Use growth curve analysis, oxygen electrode measurements, and quantitative proteomics to obtain numerical data suitable for statistical analysis.

This comprehensive approach will distinguish between complete, partial, and non-functional complementation, providing insights into structure-function relationships of the COI1 protein.

How might researchers investigate the evolutionary significance of YDR381C-A/COI1 given its absence in higher eukaryotes?

The absence of YDR381C-A/COI1 homologues in higher eukaryotes raises intriguing evolutionary questions. To investigate this aspect, researchers should:

  • Conduct comprehensive phylogenetic analysis: Search for functional analogues (not just sequence homologues) across fungal species and other lower eukaryotes to map the evolutionary history of this protein.

  • Perform comparative functional studies: Examine whether other fungi employ similar or divergent mechanisms for respiratory complex assembly.

  • Investigate functional complementation across species: Test whether YDR381C-A/COI1 from diverse fungal species can complement the yeast coi1Δ mutant.

  • Identify alternative assembly factors in higher eukaryotes: Characterize proteins in higher eukaryotes that perform analogous functions in respiratory complex assembly despite lacking sequence similarity.

  • Explore the co-evolution of mitochondrial complexes and their assembly factors: Analyze how changes in respiratory chain components correlate with the presence/absence of specific assembly factors like COI1.

This research direction could reveal evolutionary adaptations in mitochondrial complex assembly pathways and provide insights into how different organisms have developed unique solutions to the challenge of respiratory chain biogenesis.

What advanced structural biology approaches would be most informative for understanding YDR381C-A/COI1 function?

Understanding the structural basis of YDR381C-A/COI1 function requires advanced structural biology techniques:

  • Cryo-electron microscopy: For membrane proteins like COI1, cryo-EM is particularly valuable for determining structure in a near-native environment. This could reveal how COI1 interacts with respiratory chain components during assembly.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, NMR, SAXS, computational modeling) to overcome the challenges of studying a small membrane protein.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of COI1 that undergo conformational changes upon binding to partner proteins or membrane lipids.

  • Single-particle electron microscopy of assembly intermediates: Capturing snapshots of the assembly process with and without COI1 to determine its structural role.

  • Molecular dynamics simulations: Computational approaches to model COI1's interactions with the mitochondrial outer membrane and with respiratory chain components.

Such structural studies would benefit from the recombinant expression systems described earlier , potentially with modifications to enhance protein stability and facilitate structural analysis.

What are the optimal conditions for maintaining yeast strains with YDR381C-A/COI1 mutations for long-term studies?

For maintaining yeast strains with YDR381C-A/COI1 mutations in long-term studies:

  • Storage conditions: Store strains as glycerol stocks (25% glycerol) at -80°C for long-term preservation. Maintain working stocks on appropriate selection media at 4°C for up to 1-2 months.

  • Growth media considerations:

    • For routine maintenance: Use glucose-based media (YPD or synthetic complete with appropriate selection)

    • For respiratory phenotype assessment: Use glycerol or ethanol-based media (YPG/YPE)

    • For temperature-sensitive phenotypes: Maintain duplicate cultures at both permissive (30°C) and restrictive temperatures

  • Strain verification: Regularly verify the genotype through PCR and functional assays to ensure genetic stability, particularly when studying respiratory function where suppressor mutations can arise.

  • Mitochondrial DNA stability: Monitor mitochondrial DNA status, as respiratory-deficient mutants can accumulate secondary mitochondrial DNA mutations (petites) that complicate phenotypic analysis.

  • Standardized growth conditions: Ensure consistent growth phases for experiments, as mitochondrial function varies significantly with metabolic state.

These practices ensure experimental reproducibility and prevent the accumulation of secondary mutations that might confound interpretation of COI1-specific phenotypes.

What are the most effective approaches for analyzing respiratory complex assembly in YDR381C-A/COI1 mutants?

For comprehensive analysis of respiratory complex assembly in YDR381C-A/COI1 mutants, researchers should employ multiple complementary techniques:

  • Blue Native PAGE: This technique preserves native protein complexes and can be coupled with:

    • In-gel activity assays to assess functional integrity

    • Second-dimension SDS-PAGE to identify subunit composition

    • Western blotting with complex-specific antibodies

  • Sucrose gradient ultracentrifugation: For separation and quantification of individual complexes and supercomplexes based on size.

  • Quantitative proteomics: Mass spectrometry-based approaches to:

    • Measure absolute abundance of complex subunits

    • Compare assembly intermediate accumulation between wild-type and coi1Δ strains

    • Identify differential post-translational modifications

  • Mitochondrial import and assembly assays: In vitro systems to track the assembly process in isolated mitochondria from wild-type and mutant strains.

  • Pulse-chase experiments: To distinguish between assembly defects and instability of fully assembled complexes.

The combination of these approaches provides a multi-dimensional view of how COI1 contributes to the biogenesis and maintenance of respiratory chain complexes.

TechniqueApplicationAdvantagesLimitations
Blue Native PAGENative complex visualizationPreserves interactions, can couple with activity assaysLimited resolution for very large complexes
Sucrose GradientComplex separation by sizeGood for supercomplex analysisTime-consuming, semi-quantitative
Mass SpectrometrySubunit quantificationHighly sensitive, can identify modificationsRequires specialized equipment
Import AssaysAssembly process trackingTemporal resolution of assembly stepsIn vitro system may not fully recapitulate in vivo conditions
Pulse-ChaseStability assessmentDistinguishes assembly from degradationRequires metabolic labeling

What are the unresolved questions about YDR381C-A/COI1 that present opportunities for novel research?

Despite recent characterization as a respiratory chain assembly factor , numerous aspects of YDR381C-A/COI1 function remain unresolved:

  • Precise molecular mechanism: How does COI1 facilitate the assembly of complexes III and IV and their incorporation into supercomplexes? Does it function as a chaperone, scaffold, or in another capacity?

  • Regulatory aspects: Is COI1 expression or activity regulated in response to metabolic conditions or cellular stress? Are there post-translational modifications that affect its function?

  • Interaction dynamics: What is the temporal sequence of COI1's interactions during the assembly process? Which domains mediate specific protein-protein interactions?

  • Submitochondrial localization: While described as a mitochondrial outer membrane protein , how does it influence the assembly of inner membrane complexes? Does it participate in contact sites between mitochondrial membranes?

  • Broader cellular roles: Does COI1 have functions beyond respiratory chain assembly, potentially in mitochondrial dynamics, stress response, or communication with other cellular pathways?

Each of these questions represents an opportunity for researchers to make significant contributions to understanding this protein's role in mitochondrial biology.

How might synthetic biology approaches be applied to further characterize YDR381C-A/COI1 function?

Synthetic biology offers innovative approaches for YDR381C-A/COI1 functional characterization:

  • Domain swapping and minimal functional unit identification: Creating chimeric proteins by swapping domains between COI1 and other mitochondrial proteins to identify the essential functional regions.

  • Optogenetic control of COI1 activity: Engineering light-responsive variants to temporally control COI1 function, allowing precise investigation of its role at different stages of complex assembly.

  • Synthetic interaction networks: Reconstructing the respiratory chain assembly pathway with defined components in heterologous systems to determine the minimal requirements for COI1 function.

  • Expanded genetic code approaches: Incorporating non-canonical amino acids at specific positions to probe structure-function relationships and create photo-crosslinkable variants for capturing transient interactions.

  • CRISPR-based transcriptional reporters: Developing systems to monitor COI1 expression in real-time under various physiological conditions.

These synthetic biology approaches can complement traditional biochemical and genetic methods, providing unprecedented control over protein function and allowing investigators to address questions that are difficult to approach with conventional techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.