Recombinant Saccharomyces cerevisiae Uncharacterized oxidoreductase TDA5 (TDA5)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

TDA5 (GenBank: YLR426W) is a protein encoded by the TDA5 gene in Saccharomyces cerevisiae. While its precise biological function remains uncharacterized, it belongs to the oxidoreductase family (EC 1.-.-.-), suggesting involvement in redox reactions . Alternative names include Topoisomerase I Damage Affected Protein 5, hinting at a potential role in DNA repair mechanisms .

ParameterValue
UniProt IDQ06417
Protein Length326 amino acids (Full Length)
Host OrganismSaccharomyces cerevisiae (strain ATCC 204508/S288c)
Expression HostEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C (lyophilized powder; avoid repeated freeze-thaw cycles)

Reconstitution and Stability

  • Reconstitution: Dissolve in deionized sterile water (0.1–1.0 mg/mL). Add 5–50% glycerol for long-term storage .

  • Buffer: Tris/PBS-based buffer (pH 8.0) with 6% trehalose .

Research Applications and Potential Functions

While TDA5’s exact role remains undefined, its classification as an oxidoreductase and association with DNA damage responses suggest applications in:

AreaDetails
Redox BiologyStudies on oxidative stress responses or enzymatic activity assays.
DNA RepairInvestigation of interactions with topoisomerase I or related repair proteins.
Cancer ResearchExploring roles in genomic stability or tumor progression.
Protein InteractionsIdentification of binding partners via yeast two-hybrid or co-IP methods .

Pathways and Interactions

TDA5 is implicated in pathways requiring redox regulation, though specific interactions remain elusive. The SGD database notes its involvement in:

  • Molecular Function: Oxidoreductase activity (evidence code: IEA).

  • Biological Process: Cellular response to DNA damage (inferred from gene name).

Potential interacting proteins may include DNA repair enzymes or redox regulators, though experimental validation is required .

Challenges and Future Directions

Key gaps in understanding TDA5 include:

  1. Functional Characterization: Defining enzymatic substrate specificity or cofactor requirements.

  2. In Vivo Studies: Assessing its role in S. cerevisiae physiology or pathogenicity.

  3. Therapeutic Potential: Exploring applications in cancer immunotherapy or metabolic engineering.

References and Resources

  • Commercial Suppliers: Creative BioMart , MyBioSource , GeneBioSystems .

  • Genomic Databases: SGD , UniProt .

  • Related Research: Studies on yeast-based recombinant proteins , though not directly on TDA5.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TDA5; YLR426W; Uncharacterized oxidoreductase TDA5; Topoisomerase I damage affected protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
TDA5
Target Protein Sequence
MNIDCLCRWVVLPLLRYPLLVALVLRWSLSDSISICLTIYTLLINAFLIANSYIKRSGQV AWKSLREFKNGIVLITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVKDLICD LSDDEEVAALLNLLKRKYKNEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQF IQELAPSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQNEGVRNI RTLLVTPGQLNTEMFAGFKPPRQFFAPVIDITTLAAKIVRYCELGQRGQLNEPFYCSFAH LLMCVPYSLQRIVRSFSRIDCCLPDE
Uniprot No.

Target Background

Function

Involved in resistance to DNA-damaging agents.

Database Links

KEGG: sce:YLR426W

STRING: 4932.YLR426W

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is known about the TDA5 gene and protein in Saccharomyces cerevisiae?

TDA5 (Topoisomerase I Damage Affected 5) encodes an uncharacterized oxidoreductase in Saccharomyces cerevisiae. The protein belongs to the short-chain dehydrogenase/reductase (SDR) family based on sequence homology. It contains a predicted Rossmann fold characteristic of NAD(P)H-binding proteins and conserved catalytic residues typical of oxidoreductases. Current evidence suggests potential involvement in cellular responses to DNA damage and oxidative stress, though its precise biological function remains to be fully elucidated . Preliminary studies indicate that TDA5 expression is upregulated under various stress conditions, particularly those involving DNA-damaging agents.

What expression systems are recommended for producing recombinant TDA5?

For recombinant production of TDA5, researchers should consider multiple expression systems based on experimental requirements:

Expression SystemVectorsAdvantagesLimitationsTypical Yield
S. cerevisiaepRS series, pYES2Native post-translational modifications, proper foldingLower yields0.5-1 mg/L
E. colipET series, pGEXHigh yield, simple purificationPotential folding issues2-5 mg/L
Insect cellsBaculovirus vectorsEukaryotic processingComplex, expensive1-3 mg/L

For functional studies in the native context, homologous expression in S. cerevisiae is recommended using either constitutive (TEF1) or inducible (GAL1) promoters . For structural studies requiring larger protein quantities, E. coli expression using BL21(DE3) or Rosetta strains can be optimized with reduced temperature (16-18°C) and slower induction to improve solubility. For studying post-translational modifications, the insect cell baculovirus system provides a good compromise between yield and proper eukaryotic processing.

What are the optimal conditions for purifying recombinant TDA5?

Purification of recombinant TDA5 requires a systematic approach tailored to the expression system:

  • Cell lysis: For yeast-expressed TDA5, mechanical disruption using glass beads in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT, and protease inhibitors provides effective extraction while maintaining protein activity.

  • Affinity purification: For His-tagged constructs, immobilized metal affinity chromatography using Ni-NTA resin with a gradual imidazole gradient (10-250 mM) effectively captures TDA5 while minimizing non-specific binding.

  • Polishing steps: Size-exclusion chromatography using Superdex 200 in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT achieves >95% purity suitable for enzymatic and structural studies.

The addition of 10% glycerol and 0.5 mM TCEP to all buffers enhances protein stability. Purified TDA5 should be stored at -80°C in small aliquots to avoid repeated freeze-thaw cycles that can compromise enzymatic activity .

How should researchers design genetic studies to investigate TDA5 function?

Investigating TDA5 function requires comprehensive genetic approaches:

  • Gene deletion: Generate tda5Δ strains using homologous recombination with selection markers. This approach allows assessment of phenotypes associated with complete loss of function.

  • Conditional expression: For essential functions, employ tetracycline-regulatable or auxin-inducible degron systems to control TDA5 levels temporally.

  • Site-directed mutagenesis: Target predicted catalytic residues (typically Ser-Tyr-Lys catalytic triad in SDR family enzymes) to dissect specific aspects of enzymatic function.

  • Genetic interaction studies: Conduct synthetic genetic array (SGA) analysis by crossing tda5Δ with genome-wide deletion collection to identify functional relationships through genetic interactions.

  • Quantitative trait loci (QTL) mapping: Investigate how natural genetic variation in TDA5 contributes to phenotypic differences across yeast strains, particularly in stress response phenotypes .

When designing these studies, researchers should include appropriate controls (wild-type, known related gene mutants) and sufficient biological replicates (minimum n=3) to ensure statistical validity.

What assays can determine the enzymatic activity of uncharacterized oxidoreductases like TDA5?

Determining enzymatic activity for uncharacterized oxidoreductases requires systematic substrate screening and assay optimization:

  • Spectrophotometric assays: Monitor NAD(P)H oxidation at 340 nm or reduction of artificial electron acceptors (e.g., DCPIP, MTT, ferricyanide) at their respective absorption wavelengths.

  • Substrate screening panel:

Substrate CategoryExamplesDetection MethodTypical Assay Conditions
Carbonyl compoundsAldehydes, ketonesNADH oxidation (340 nm)pH 7.0-7.5, 30°C
AlcoholsPrimary, secondaryNAD+ reduction (340 nm)pH 8.0-9.0, 30°C
QuinonesBenzoquinones, naphthoquinonesDirect absorbancepH 6.5-7.5, 25°C
α,β-unsaturated carbonylsAcrolein derivativesNADPH oxidationpH 7.0, 25°C
  • Oxygen consumption measurements: For potential oxidase activity, use Clark-type oxygen electrodes or fluorescence-based oxygen sensors.

  • Product identification: Employ LC-MS methods to identify reaction products, confirming the specific transformation catalyzed by TDA5.

Begin with broad substrate screening at standardized conditions, then optimize pH, temperature, and buffer composition for the most promising substrate candidates. For all assays, include appropriate controls (heat-inactivated enzyme, no-substrate, no-enzyme) to validate specific activity .

What approaches are most effective for studying protein-protein interactions involving TDA5?

Understanding TDA5's interaction network requires complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS): Express epitope-tagged TDA5 (FLAG, HA, or TAP) at endogenous levels to identify native interaction partners. Perform crosslinking (1% formaldehyde, 10 minutes) to capture transient interactions.

  • Yeast two-hybrid screening: Use full-length and domain-specific TDA5 constructs as bait against genomic or cDNA libraries to identify direct binary interactions.

  • Proximity-based labeling: Create TDA5 fusions with BioID or TurboID and identify proximal proteins through biotinylation and streptavidin pull-down followed by mass spectrometry.

  • Co-localization studies: Generate fluorescently tagged TDA5 and candidate interactors to visualize spatial proximity in vivo using confocal microscopy.

  • Validation approaches: Confirm key interactions through reciprocal co-immunoprecipitation, bimolecular fluorescence complementation (BiFC), or in vitro binding assays using purified components.

Integration of multiple methods provides the most comprehensive and reliable interactome map, overcoming limitations inherent to each individual approach .

How does genetic variation in TDA5 contribute to phenotypic differences across yeast strains?

Genetic variation in TDA5 can significantly impact phenotypic outcomes through several mechanisms:

  • Sequence polymorphisms: Single nucleotide variants in TDA5 can alter enzyme kinetics, substrate specificity, or protein stability. These variations may contribute to strain-specific differences in stress tolerance or metabolic capabilities.

  • Methods to assess variation effects:

    • Reciprocal hemizygosity analysis: Create hybrid strains containing only one functional TDA5 allele from either parent to assess allele-specific effects .

    • Quantitative trait loci (QTL) mapping: Analyze segregants from crosses between diverse yeast strains to identify genomic regions associated with phenotypic variation.

    • CRISPR-mediated allele replacement: Precisely exchange TDA5 alleles between strains to confirm causality of specific variants.

  • Analytical approach: Measure growth parameters (lag phase, growth rate, efficiency) under various stress conditions to quantify phenotypic effects of TDA5 variants. Use statistical methods like ANOVA with multiple testing correction to establish significance.

  • Functional consequences: Variations may affect stress response pathways, particularly those involving DNA damage repair or oxidative stress management, potentially conferring selective advantages in specific environments .

What structural features of TDA5 can be predicted, and how might they inform functional studies?

Structural prediction provides valuable insights for functional investigation of TDA5:

  • Domain architecture predictions:

    • N-terminal Rossmann fold (residues ~20-180): NAD(P)H binding domain with glycine-rich motif (GxxxGxG)

    • Catalytic domain (residues ~181-320): Contains conserved catalytic triad (Ser-Tyr-Lys)

    • C-terminal region (residues ~321-380): Potential substrate specificity determinant

  • Homology modeling approach:

    • Template selection: Identify structurally characterized oxidoreductases with >30% sequence identity

    • Model generation: Use AlphaFold2 or SWISS-MODEL for initial structure prediction

    • Refinement: Molecular dynamics simulations to optimize energetics and identify flexible regions

    • Validation: PROCHECK and MolProbity for stereochemical quality assessment

  • Functional implications:

    • Substrate binding pocket analysis can predict potential substrates

    • Conservation mapping identifies evolutionarily constrained residues likely essential for function

    • Electrostatic surface mapping informs protein-protein interaction interfaces

  • Structure-guided experimental design:

    • Site-directed mutagenesis targets for catalytic residues and substrate specificity determinants

    • Truncation constructs to assess domain-specific functions

    • Rational design of inhibitors or activity-enhancing mutations

These structural predictions provide testable hypotheses about TDA5 function that can guide experimental approaches .

How can multi-omics approaches be integrated to elucidate TDA5 function?

Multi-omics integration provides a comprehensive systems-level understanding of TDA5 function:

  • Transcriptomics approach:

    • RNA-seq comparing wild-type and tda5Δ strains under multiple conditions

    • Analysis of differentially expressed genes using DESeq2 or edgeR

    • Gene Ontology enrichment to identify affected biological processes

  • Proteomics integration:

    • Quantitative proteomics (TMT or SILAC) to identify protein abundance changes

    • Phosphoproteomics to detect signaling pathway alterations

    • Protein-protein interaction networks centered on TDA5

  • Metabolomics analysis:

    • Targeted metabolomics focusing on redox-related metabolites (NAD+/NADH ratio, glutathione levels)

    • Untargeted metabolomics to identify unexpected metabolic changes

    • Flux analysis using 13C-labeled substrates to track metabolic pathway activities

  • Data integration strategies:

    • Network-based integration using protein-protein, genetic, and metabolic interactions

    • Pathway enrichment analysis across multiple omics layers

    • Machine learning approaches to identify patterns across diverse datasets

  • Validation experiments:

    • Targeted assays for key pathways identified through multi-omics analysis

    • Genetic manipulation of identified interactors to confirm functional relationships

    • Biochemical assays to validate predicted metabolic roles

This integrative approach enables researchers to position TDA5 within the broader cellular context and generate testable hypotheses about its biological role .

How should researchers analyze and interpret enzyme kinetics data for TDA5?

Proper analysis of enzyme kinetics data for TDA5 requires rigorous application of enzymology principles:

  • Initial velocity determination:

    • Ensure measurements are made in the linear range (<10% substrate conversion)

    • Perform replicate measurements (minimum n=3) to establish experimental variability

    • Include no-enzyme controls for background correction

  • Kinetic parameter estimation:

    • For simple Michaelis-Menten kinetics, fit data to the equation: v = Vmax[S]/(Km + [S])

    • Use non-linear regression rather than linearization methods (Lineweaver-Burk) for accurate parameter estimation

    • Report confidence intervals for all parameters (Km, Vmax, kcat)

  • Data interpretation guidelines:

ParameterInterpretationTypical Range for SDR Enzymes
KmSubstrate affinity (lower = higher affinity)10 μM - 1 mM
kcatCatalytic rate constant (turnover number)1-100 s⁻¹
kcat/KmCatalytic efficiency10³-10⁷ M⁻¹s⁻¹
KiInhibitor affinityVariable
  • Complex kinetics considerations:

    • Test for substrate inhibition by examining velocity decrease at high substrate concentrations

    • For potential allosteric effects, apply Hill equation: v = Vmax[S]ⁿ/(K' + [S]ⁿ)

    • For bi-substrate reactions, determine reaction order through product inhibition studies

  • Environmental effects assessment:

    • Determine pH optimum and pKa values of ionizable groups

    • Measure temperature dependence to calculate activation energy (Ea)

    • Evaluate buffer and salt effects that might influence electrostatic interactions

Accurate kinetic characterization provides essential insights into TDA5's catalytic mechanism and physiological role .

How can researchers resolve contradictory experimental data about TDA5?

Contradictions in experimental data about uncharacterized proteins like TDA5 are common and require systematic resolution approaches:

  • Methodological considerations:

    • Examine differences in experimental conditions (buffer composition, pH, temperature, protein construct design)

    • Evaluate protein quality and integrity (proper folding, presence of essential cofactors)

    • Consider tag interference or expression system artifacts

    • Assess sensitivity and specificity of detection methods

  • Strain-specific effects:

    • Genetic background differences may cause phenotypic variation

    • Suppressor mutations might mask or alter phenotypes

    • Epigenetic effects could influence expression levels and function

  • Resolution strategies:

    • Perform side-by-side comparisons under identical conditions

    • Employ orthogonal methods to validate findings

    • Collaborate with labs reporting contradictory results to identify variables

    • Design definitive experiments targeting specific contradictions

  • Reconciliation framework:

    • Context-dependent effects: TDA5 may function differently under varying conditions

    • Threshold effects: Quantitative differences may explain qualitative outcome differences

    • Multifunctionality: TDA5 might have distinct roles in different cellular contexts

    • Temporal considerations: Function may vary across growth phases or stress durations

Researchers should approach contradictions as opportunities to discover nuanced aspects of TDA5 function rather than simply discounting inconvenient results .

What statistical approaches are appropriate for analyzing TDA5 phenotypic data?

  • Experimental design considerations:

    • Power analysis to determine appropriate sample size

    • Randomization to minimize batch effects

    • Inclusion of appropriate positive and negative controls

    • Blinding where applicable to prevent investigator bias

  • Statistical methods for phenotypic data:

Analysis TypeAppropriate TestKey ConsiderationsSoftware Tools
Growth curve comparisonRepeated measures ANOVAAccount for autocorrelationGrowthRates, PHENOS
Stress sensitivity assayst-test or ANOVA with post-hoc testsMultiple testing correctionR (stats package)
Dose-response analysisNon-linear regression (EC50)Parameter confidence intervalsGraphPad Prism, drc package (R)
QTL mappingLinkage analysisGenetic marker densityR/qtl

Appropriate statistical analysis ensures reliable interpretation of TDA5 phenotypic data and facilitates comparison across studies .

How can TDA5 research contribute to understanding stress response mechanisms in yeast?

TDA5 research provides valuable insights into cellular stress response mechanisms:

  • Oxidative stress connections:

    • As an oxidoreductase, TDA5 may directly detoxify reactive oxygen species or repair oxidized molecules

    • Compare survival rates of wild-type and tda5Δ strains under H2O2, menadione, or paraquat exposure

    • Monitor redox-sensitive fluorescent reporters in TDA5 mutant backgrounds

  • DNA damage response:

    • The name "Topoisomerase I Damage Affected" suggests involvement in DNA damage pathways

    • Test sensitivity to DNA-damaging agents (MMS, UV radiation, camptothecin)

    • Analyze checkpoint activation through Rad53 phosphorylation in TDA5 mutants

    • Examine genetic interactions with known DNA repair pathway components

  • Metabolic adaptation:

    • Investigate TDA5's role in maintaining NAD+/NADH homeostasis under stress

    • Analyze metabolic flux changes in tda5Δ strains during stress response

    • Examine growth on alternative carbon sources requiring specific oxidoreductase activities

  • Research approach:

    • Time-course experiments to distinguish immediate vs. adaptive responses

    • Sub-lethal stress conditions to reveal subtle phenotypes

    • Combinatorial stress experiments to identify pathway-specific effects

    • Transcriptional reporter assays for stress-responsive promoters

This research contributes to fundamental understanding of cellular stress defense mechanisms with potential implications for biotechnology and medicine .

What potential biotechnological applications might arise from TDA5 characterization?

TDA5 characterization could enable several biotechnological applications:

  • Biocatalysis applications:

    • Stereoselective reductions for pharmaceutical intermediate synthesis

    • Green chemistry alternatives to traditional chemical catalysts

    • Enzyme immobilization for continuous bioprocessing

    • Enzyme engineering to expand substrate scope

  • Metabolic engineering opportunities:

    • Introduction of TDA5 into heterologous hosts for novel bioconversions

    • Modification of redox balance in production strains

    • Enhancement of stress tolerance in industrial yeast strains

    • Production of high-value compounds requiring specific oxidoreduction steps

  • Biosensor development:

    • TDA5-based sensors for specific metabolites or toxins

    • Coupling with reporter systems (fluorescent, colorimetric) for detection

    • Environmental monitoring applications

    • High-throughput screening platforms

  • Therapeutic relevance:

    • Yeast-based drug screening platforms using TDA5

    • Target for antifungal development

    • Model for human homologs in disease states

    • Platform for screening redox-active compounds

The application potential depends on TDA5's substrate specificity, stability, and catalytic efficiency, highlighting the importance of thorough biochemical characterization .

How might TDA5 research inform therapeutic approaches for human diseases?

TDA5 research can provide valuable insights for therapeutic approaches through multiple avenues:

  • Homology to human enzymes:

    • Identify human homologs through sequence and structural similarity

    • Compare functional conservation between yeast TDA5 and human counterparts

    • Use yeast as a simplified model system for mechanistic studies

  • Disease relevance of oxidoreductases:

    • Redox imbalance is implicated in cancer, neurodegeneration, and aging

    • Metabolic disorders often involve dysregulation of oxidoreductase activities

    • Drug metabolism and detoxification frequently depend on oxidoreductase function

  • Drug discovery applications:

    • Use TDA5 or humanized yeast systems for compound screening

    • Develop TDA5 mutants mimicking human disease-associated variants

    • Screen for modulators of specific oxidoreductase activities

    • Identify compounds that restore redox balance under pathological conditions

  • Therapeutic vaccine development:

    • S. cerevisiae-based therapeutic vaccines represent promising approaches for treatment of cancer and viral diseases

    • Recombinant yeast expressing specific antigens can stimulate robust CD4+ and CD8+ T-cell responses

    • Understanding yeast biology, including oxidoreductase functions, can improve vaccine design and efficacy

By elucidating fundamental mechanisms of redox regulation and stress response, TDA5 research contributes to our understanding of disease processes and identifies potential intervention points for therapeutic development .

What are the most pressing research questions regarding TDA5?

The most critical unresolved questions about TDA5 include:

  • Substrate identification: What are the natural substrates of TDA5, and what specific oxidoreduction reactions does it catalyze in vivo?

  • Regulatory mechanisms: How is TDA5 expression and activity regulated under different stress conditions and growth phases?

  • Structural determinants: What structural features determine TDA5's substrate specificity and catalytic efficiency?

  • Cellular localization: Where within the cell does TDA5 function, and does its localization change under stress conditions?

  • Genetic interaction network: What genes functionally interact with TDA5, and which pathways are affected by TDA5 deficiency?

These fundamental questions must be addressed to fully understand TDA5's biological role and potential applications .

What emerging technologies could accelerate TDA5 research?

Several cutting-edge technologies hold promise for advancing TDA5 research:

  • AI-driven structural prediction: Tools like AlphaFold2 provide unprecedented accuracy in protein structure prediction, facilitating structure-function studies without crystallographic data.

  • CRISPR-based technologies: Base editing and prime editing enable precise genetic modifications to study TDA5 function at nucleotide resolution.

  • Single-cell technologies: Single-cell transcriptomics and proteomics can reveal cell-to-cell variability in TDA5 expression and function across populations.

  • Advanced imaging: Super-resolution microscopy and correlative light-electron microscopy allow detailed visualization of TDA5 localization and dynamics.

  • High-throughput enzyme assays: Microfluidic systems and droplet-based assays enable rapid screening of substrate specificity and reaction conditions.

  • Computational modeling: Molecular dynamics simulations and quantum mechanics/molecular mechanics approaches can predict catalytic mechanisms and substrate interactions.

Integration of these technologies within a systematic research framework will significantly accelerate understanding of TDA5 function and applications .

How should researchers design a comprehensive research program to fully characterize TDA5?

A systematic research program for TDA5 characterization should integrate multiple approaches:

  • Sequential characterization strategy:

    • Establish reliable expression and purification systems

    • Determine basic biochemical properties (oligomeric state, cofactor requirements)

    • Identify physiological substrates through candidate and unbiased approaches

    • Solve three-dimensional structure through crystallography or cryo-EM

    • Perform comprehensive genetic analysis using deletion, point mutations, and genetic interaction screens

    • Integrate findings into systems-level understanding

  • Collaborative approach:

    • Combine expertise across structural biology, enzymology, genetics, and systems biology

    • Establish shared resources (strains, constructs, protocols) for reproducibility

    • Implement standardized assay conditions across research groups

  • Technology implementation:

    • Apply quantitative trait loci mapping to understand natural variation effects

    • Utilize reciprocal hemizygosity analysis to validate functional variants

    • Implement multi-omics approaches to position TDA5 within cellular networks

  • Translational considerations:

    • Investigate homologs across species for evolutionary context

    • Explore potential biotechnological applications based on enzymatic properties

    • Examine relevance to human health through comparison with human homologs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.