Recombinant Saccharomyces cerevisiae Uncharacterized oxidoreductase YKL107W (YKL107W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
YKL107W; YKL462; Uncharacterized oxidoreductase YKL107W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YKL107W
Target Protein Sequence
MFWKKDPTVSWERKNINDIDFSRFNVAIIGGTGGLGRAISRELAQRNARVTVVGQTFRDE DLKDKINFVKADLSLVSECKRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMA VSYLSRYIIFHDVAKRLGISRTKKDDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATH MNTVAANESLVIDAKDRYTNIDTFGLNPGLIKTNIRNNLLGSDTYLSRITEWIISWTCQS AETYAKTICTLIASPAIESRSGTMFSNKGDAILPSPGLTKDVVEKFMENSELLVEKALRN QSPFTSSNE
Uniprot No.

Target Background

Database Links

KEGG: sce:YKL107W

STRING: 4932.YKL107W

Protein Families
NmrA-type oxidoreductase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YKL107W and what enzymatic activity does it demonstrate?

YKL107W encodes a novel aldehyde reductase (Ykl107wp) from Saccharomyces cerevisiae that belongs to the classical short-chain dehydrogenase/reductase (SDR) family. This enzyme specifically catalyzes the reduction reactions of various aldehydes including acetaldehyde (AA), glycolaldehyde (GA), furfural (FF), formaldehyde (FA), and propionaldehyde (PA). Notably, the enzyme exhibits substrate specificity toward aldehydes and cannot reduce a panel of six representative ketones tested in experimental studies .

The primary function of Ykl107wp appears to be cellular detoxification, as it catalyzes the conversion of potentially harmful aldehydes to their corresponding alcohols. This enzymatic activity is particularly important for yeast survival in environments containing aldehydes such as furfural, which is a common inhibitor found in lignocellulosic hydrolysates used in bioethanol production .

What is the subcellular localization of Ykl107wp and why is it significant?

Ykl107wp has been definitively localized to the endoplasmic reticulum (ER) in Saccharomyces cerevisiae, as determined through protein-GFP localization studies . This localization is significant for several reasons:

  • It suggests a specialized role in protecting ER-associated processes from aldehyde toxicity

  • It indicates potential involvement in metabolic pathways that occur in or interact with the ER

  • It provides clues about the enzyme's natural substrates and physiological roles

  • It may influence the protein's post-translational modifications and regulation

The ER-specific localization allows Ykl107wp to participate in the detoxification of aldehydes that might otherwise damage ER membranes or disrupt protein folding. This localization pattern offers insight into developing organelle-specific protection strategies in yeast strains engineered for enhanced aldehyde tolerance .

How does Ykl107wp contribute to cellular protection against aldehydes?

Ykl107wp provides protection to yeast cells primarily through its ability to detoxify harmful aldehydes by converting them to less toxic alcohols. Experimental evidence specifically demonstrates that Ykl107wp prevents cellular damage caused by furfural by catalyzing its reduction to furfural alcohol .

The protective mechanism involves:

  • Recognition and binding of aldehyde substrates

  • NADPH-dependent reduction of the aldehyde functional group

  • Release of the corresponding alcohol product

  • Regeneration of the enzyme for subsequent catalytic cycles

This detoxification process is particularly important when yeast cells are exposed to environments containing furfural and other aldehydes, such as during fermentation of lignocellulosic biomass. The enzyme's activity directly contributes to enhanced tolerance against these inhibitory compounds, potentially improving yeast survival and fermentation efficiency in industrial applications .

What are the basic biochemical properties of Ykl107wp?

Ykl107wp demonstrates several key biochemical properties that define its function as an aldehyde reductase:

PropertyCharacteristics
Enzyme ClassificationAldehyde reductase; Short-chain dehydrogenase/reductase (SDR) family
Substrate SpecificityReduces aldehydes (AA, GA, FF, FA, PA); Cannot reduce ketones
Cofactor RequirementNADPH-dependent
Highest AffinityAcetaldehyde (lowest Km value)
Best Catalytic EfficiencyAcetaldehyde (highest Kcat/Km)
pH Optima6.0 (for AA), 7.0 (for GA and FF)
Temperature Optima40°C (AA), 35°C (GA), 30°C (FF)
StabilityPoor thermal and pH stability; Slightly affected by substrates

The enzyme exhibits the highest affinity and catalytic efficiency toward acetaldehyde, suggesting this may be its primary physiological substrate. Its activity is significantly influenced by metal ions, chemical additives, and salts, indicating potential regulatory mechanisms in the cellular environment .

What methodologies are recommended for characterizing Ykl107wp enzyme kinetics?

For comprehensive characterization of Ykl107wp enzyme kinetics, researchers should employ a multi-faceted approach:

  • Recombinant Expression and Purification: Express the YKL107W gene in a suitable host system (E. coli or yeast) with an affinity tag for purification. Confirm protein integrity through SDS-PAGE and Western blotting.

  • Spectrophotometric Assays: Monitor NADPH consumption at 340 nm during aldehyde reduction reactions. For accurate kinetic parameter determination:

    • Maintain substrate concentrations ranging from 0.2Km to 5Km

    • Use appropriate buffer systems for each pH range tested

    • Perform reactions at constant temperature with temperature control systems

    • Include controls to account for non-enzymatic NADPH oxidation

  • Substrate Specificity Analysis: Test a panel of aldehydes and ketones under standardized conditions to determine:

    • Km values (measure of affinity)

    • Vmax (maximum reaction velocity)

    • Kcat (catalytic rate constant)

    • Kcat/Km (catalytic efficiency)

  • Influence of Environmental Factors: Systematically evaluate the effects of:

    • pH (range 4.0-9.0)

    • Temperature (20-50°C)

    • Metal ions (various concentrations)

    • Chemical additives

    • Ionic strength

For comprehensive analysis of Ykl107wp with acetaldehyde, it is recommended to use pH 6.0 and 40°C as starting conditions, since these have been identified as optimal for this substrate .

How can researchers investigate the structure-function relationship of Ykl107wp?

To elucidate the structure-function relationship of Ykl107wp, researchers should consider the following methodological approach:

  • Sequence Analysis and Homology Modeling:

    • Perform multiple sequence alignment with characterized SDR family members

    • Identify conserved motifs, particularly the catalytic tetrad (N-S-Y-K) and cofactor binding site

    • Generate homology models based on structurally resolved SDR proteins

    • Validate models through energy minimization and Ramachandran plot analysis

  • Site-Directed Mutagenesis:

    • Target predicted catalytic residues and substrate binding pocket residues

    • Create single and multiple mutations to analyze their effects on:

      • Substrate specificity

      • Catalytic efficiency

      • pH optima

      • Temperature stability

  • Protein Structure Determination:

    • Express and purify protein in sufficient quantities for structural studies

    • Attempt X-ray crystallography of the protein with and without substrates/cofactors

    • Alternative approaches include cryo-electron microscopy or NMR spectroscopy for dynamic analysis

  • Molecular Dynamics Simulations:

    • Simulate enzyme-substrate interactions in silico

    • Model pH and temperature effects on protein structure

    • Predict the effects of mutations on protein stability and function

  • Substrate Docking Studies:

    • Perform in silico docking of various aldehydes to identify key interaction residues

    • Correlate binding energies with experimental Km values

    • Identify structural features that explain substrate preferences

This comprehensive approach would provide insights into why Ykl107wp shows preference for acetaldehyde and why it cannot reduce ketones, potentially enabling rational engineering of the enzyme for enhanced or altered specificity .

What approaches can be used to study YKL107W expression patterns under various conditions?

Despite the current lack of expression data for YKL107W in the Saccharomyces Genome Database , researchers can employ several methodologies to investigate its expression patterns:

  • RNA-Seq Analysis:

    • Design experiments with adequate biological replicates (minimum 3-5 per condition)

    • Expose yeast cells to different stressors, particularly aldehyde-containing environments

    • Sequence to appropriate depth (10-30 million reads per sample)

    • Perform differential expression analysis using established tools (DESeq2, edgeR)

    • Validate key findings with RT-qPCR

  • Promoter Analysis and Reporter Systems:

    • Clone the YKL107W promoter region upstream of reporter genes (GFP, luciferase)

    • Monitor expression under various conditions in real-time

    • Perform deletion analysis of promoter elements to identify regulatory regions

  • Chromatin Immunoprecipitation (ChIP):

    • Identify transcription factors binding to the YKL107W promoter

    • Perform ChIP-seq to map genome-wide binding patterns of relevant factors

    • Correlate with expression data to establish regulatory networks

  • Single-Cell Analysis:

    • Employ single-cell RNA-seq to detect cell-to-cell variation in expression

    • Use flow cytometry with fluorescent reporters to quantify expression at single-cell level

    • Identify potential sub-populations with varying expression levels

When designing RNA-Seq experiments for YKL107W expression analysis, researchers should consider power analysis tools like Scotty to determine optimal experimental parameters, including number of replicates and sequencing depth, to ensure statistical robustness .

How might Ykl107wp's poor thermal and pH stability be addressed for experimental applications?

The reported poor thermal and pH stability of Ykl107wp presents challenges for experimental and potential biotechnological applications. Several approaches can be implemented to address these limitations:

  • Protein Engineering Strategies:

    • Consensus-guided mutagenesis: Introduce residues common in thermostable SDR family members

    • Disulfide bridge engineering: Add strategically placed disulfide bonds to enhance structural rigidity

    • Surface charge optimization: Modify surface residues to improve electrostatic interactions

    • Loop stabilization: Shorten or rigidify flexible loop regions

  • Formulation and Reaction Condition Optimization:

    • Buffer composition: Test various buffer systems to identify stabilizing conditions

    • Additives: Evaluate the effects of osmolytes (glycerol, trehalose), salts, and polyols

    • Immobilization: Develop enzyme immobilization strategies on suitable carriers

    • Microenvironment engineering: Create protective microenvironments through encapsulation

  • Experimental Design Considerations:

    • Prepare fresh enzyme preparations for critical experiments

    • Establish stability curves to predict activity loss over time

    • Implement temperature-controlled reaction systems

    • Develop standardized storage conditions to minimize activity loss

  • Alternative Approaches:

    • Whole-cell biocatalysis: Use intact yeast cells expressing Ykl107wp

    • In vivo applications: Design experiments that leverage the enzyme's natural cellular environment

    • Fusion proteins: Create chimeric proteins with stability-enhancing domains

Careful monitoring of enzymatic activity is essential when working with Ykl107wp, and researchers should account for potential activity losses when interpreting kinetic data. While substrate presence has been reported to slightly improve stability, this effect may not be sufficient for extended applications requiring prolonged enzyme activity .

What strategies can be employed to investigate Ykl107wp's role in the endoplasmic reticulum?

To thoroughly investigate Ykl107wp's specific function within the endoplasmic reticulum, researchers should consider the following methodological approaches:

  • High-Resolution Localization Studies:

    • Super-resolution microscopy with organelle-specific markers

    • Immunogold electron microscopy to determine precise sub-organellar localization

    • FRET analysis with known ER proteins to identify potential interaction partners

    • Live-cell imaging to monitor dynamic localization patterns

  • ER Stress Response Analysis:

    • Examine expression changes of YKL107W during ER stress (tunicamycin, DTT treatment)

    • Analyze the unfolded protein response (UPR) activation in YKL107W deletion strains

    • Measure ER-specific reactive oxygen species (ROS) levels in wildtype vs. deletion strains

    • Investigate ER morphology changes through microscopy

  • Interactome Mapping:

    • Perform BioID or proximity labeling to identify neighboring proteins

    • Conduct co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening against an ER protein library

    • Analyze genetic interactions through synthetic genetic array (SGA) analysis

  • Functional Analysis in ER Context:

    • Measure aldehyde levels within the ER in wildtype and YKL107W deletion strains

    • Analyze lipid peroxidation products in ER membranes

    • Assess protein folding efficiency and glycosylation patterns

    • Evaluate calcium homeostasis in the ER

  • Aldehyde Challenge Experiments:

    • Localize aldehyde-protein adducts through immunohistochemistry

    • Measure ER-specific damage markers after aldehyde exposure

    • Compare ER fragmentation and autophagy induction between wildtype and deletion strains

These approaches would help establish whether Ykl107wp primarily functions to protect ER proteins and membranes from aldehyde damage, or if it participates in specific ER-associated metabolic pathways that generate or utilize aldehydes as intermediates .

How can synthetic biology approaches be applied to study or enhance YKL107W function?

Synthetic biology offers powerful tools to further characterize and enhance the function of YKL107W:

  • Genome Integration and Modification Strategies:

    • Utilize the Sc2.0 synthetic yeast chromosome platform for controlled gene modifications

    • Apply loxPsym recombination sites for inducible gene shuffling experiments

    • Implement CRISPR-Cas9 system for precise genomic editing and regulation

    • Create synthetic promoters with varying strength to modulate expression levels

  • Protein Engineering and Evolution:

    • Design libraries with targeted or random mutagenesis

    • Implement directed evolution with selective pressure from aldehydes

    • Create functional protein fusions to enhance stability or alter localization

    • Develop orthogonal enzyme pairs for novel detoxification pathways

  • Metabolic Engineering Applications:

    • Integrate YKL107W into synthetic detoxification pathways

    • Create aldehyde-responsive genetic circuits using YKL107W promoter elements

    • Design metabolic pathways that channel toxic aldehydes to Ykl107wp

    • Develop consortium-based approaches combining multiple detoxification strategies

  • Advanced Characterization Methods:

    • Implement ribosome profiling to study translation efficiency

    • Apply metabolic flux analysis to assess impact on cellular metabolism

    • Utilize proteomics to measure effects on global protein expression

    • Employ lipidomics to evaluate changes in membrane composition

When considering synthetic chromosome approaches, researchers can follow methodologies from the Sc2.0 project, which has successfully synthesized chromosome XI. Similar strategies could be applied to create YKL107W variants with removed introns, recoded sequences, and PCRTag watermarks to facilitate tracking and selection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.