Recombinant Saccharomyces cerevisiae Uncharacterized protein YAR064W (YAR064W)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

PropertyDetail
Gene IDYAR064W
UniProt IDP39563
Protein Length99 amino acids
Molecular WeightNot explicitly reported (estimated ~11 kDa based on sequence)
ParalogsYHR213W-B (segmental duplication product)
SequenceMLIDFCCSYIAGTHGRERAPSFTGTFVSHVSGENNCRPRRSEITQPCASGTEKKHFAATE KPCTNSLEGSRKDFLSLPLGHSYLFLFCFWRMICSEPKL

The protein is encoded by a gene with no confirmed functional domains or homologs outside fungi . It shares structural similarities with flocculins, though this classification remains tentative .

Functional Insights and Predicted Interactions

While direct functional studies on YAR064W are scarce, bioinformatic analyses suggest potential roles:

Predicted Protein Interactions

InteractorConfidence ScoreDescription
YAR068W0.801Uncharacterized protein induced in respiratory-deficient cells
YAR069C0.795Dubious ORF; paralogous to YHR214C-D
YAR075W0.761Inosine-5'-monophosphate dehydrogenase-like protein

These interactions hint at possible involvement in metabolic or stress-response pathways, though experimental validation is lacking .

Gene Coexpression and Regulation

  • Stress Response: Paralogs like YER067W (RGI1) are stress-induced and linked to carbohydrate metabolism . While YAR064W’s expression patterns are undocumented , its genomic context suggests analogous regulatory mechanisms.

  • Segmental Duplication: YAR064W and YHR213W-B arose from duplication events, potentially leading to functional divergence .

Research Gaps and Future Directions

  1. Functional Characterization:

    • No phenotypic data exists for YAR064W deletion mutants.

    • Structural studies (e.g., X-ray crystallography) could reveal novel folds or binding sites.

  2. Metabolic Roles:

    • Paralogs like YER067W regulate glycogen/trehalose balance ; YAR064W may modulate similar pathways.

  3. Drug Resistance:

    • Indirect evidence from related genes (e.g., YER067W’s role in antifungal tolerance) warrants investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
YAR064W; Uncharacterized protein YAR064W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YAR064W
Target Protein Sequence
MLIDFCCSYIAGTHGRERAPSFTGTFVSHVSGENNCRPRRSEITQPCASGTEKKHFAATE KPCTNSLEGSRKDFLSLPLGHSYLFLFCFWRMICSEPKL
Uniprot No.

Target Background

Database Links

KEGG: sce:YAR064W

STRING: 4932.YAR064W

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YAR064W and how is it classified in the Saccharomyces cerevisiae genome?

Q: What is the current annotation status of YAR064W in Saccharomyces cerevisiae?

A: YAR064W is classified as an uncharacterized protein in Saccharomyces cerevisiae, specifically annotated as a "pseudogenic fragment with similarity to flocculins" . Despite its pseudogenic status, STRING database analysis reveals significant protein interaction potential with 35 documented network connections, suggesting possible functional roles that have yet to be fully characterized . This 99-amino acid protein is located in a largely silent subtelomeric region, which may explain why its expression and function have been challenging to study through conventional approaches . Researchers should note that YAR064W has a paralog, YHR213W-B, which arose from segmental duplication events in the yeast genome, indicating evolutionary significance despite its uncharacterized status .

Q: How does YAR064W differ between laboratory and industrial Saccharomyces cerevisiae strains?

A: Genome structure analysis has revealed that YAR064W is duplicated in both the laboratory strain S288c and the industrial strain JAY270 at the right end of chromosome 8, indicating conservation of this duplication event across diverse yeast lineages . In detailed karyotype analysis of JAY270, researchers identified a significant chromosomal rearrangement where an approximately 12-kb translocation from the right arm of chromosome 1 (including the YAR064W gene) was present on the shorter homolog of chromosome 6 (Chr6S) but absent from the longer homolog (Chr6L) . This translocation pattern demonstrates how YAR064W participates in the dynamic chromosomal rearrangements that distinguish industrial strains from laboratory strains. Understanding these strain-specific differences is crucial for researchers studying genome plasticity in yeast, as these peripheral regions of chromosomes represent plastic domains that frequently undergo ectopic recombination and alternative structuring .

Q: What evidence exists for YAR064W expression in Saccharomyces cerevisiae?

A: RNA-sequencing data has detected reads mapping to YAR064W in transcriptomic studies, though closer inspection has revealed that most reads map to the periphery of the YAR064W coding region and likely represent the ends of transcripts from adjacent, unannotated regions . In mating-type specific gene expression studies, initial unbiased quantitative comparisons indicated potential enrichment of YAR064W transcripts in a spores, but further analysis determined this to be an artifact of neighboring transcriptional activity rather than actual differential expression of YAR064W itself . The location of YAR064W in a largely silent subtelomeric region provides one explanation for its limited expression under standard laboratory conditions. Researchers investigating YAR064W expression should employ sensitive techniques capable of detecting low-abundance transcripts and consider the possibility that expression may be condition-specific or strain-dependent, particularly given the observed genomic rearrangements involving this gene in different yeast strains .

What are the evolutionary implications of YAR064W's genomic context?

Q: How is YAR064W related to its paralog YHR213W-B, and what does this tell us about yeast genome evolution?

A: YAR064W shares paralogous relationship with YHR213W-B, both classified as pseudogenic fragments with similarity to flocculins, having originated from segmental duplication events in the yeast genome . This paralogy is part of a larger pattern observed in subtelomeric regions, where several neighboring genes also maintain paralogs, including YAR068W/YHR214W-A and YAR066W/YHR214W, indicating a block duplication event rather than independent gene duplications . Evolutionary analysis suggests that these duplications contribute to the plasticity of subtelomeric regions, which are known to be hotspots for recombination and genome innovation. Researchers interested in evolutionary genomics can use these paralogous relationships to study the rates and patterns of sequence divergence following duplication, providing insights into how new genetic functions may emerge through subfunctionalization or neofunctionalization of duplicated sequences .

Q: What role does YAR064W play in chromosomal rearrangements across different yeast strains?

A: Comparative genomic analysis between laboratory strain S288c and industrial strain JAY270 has revealed that YAR064W is involved in significant chromosomal rearrangements, specifically a translocation event where YAR064W from chromosome 1 was translocated to one of the chromosome 6 homologs in JAY270 . This translocation contributed to chromosome length polymorphisms observed between the two strains and even between homologous chromosomes within JAY270, where Chr6 exists as both short (Chr6S) and long (Chr6L) variants differing by approximately 60 kb . The involvement of YAR064W in these rearrangements supports the hypothesis that peripheral chromosomal regions represent plastic domains that readily undergo ectopic recombination. For researchers studying genome structure evolution, YAR064W serves as an excellent marker for tracking chromosomal rearrangements between strains, potentially contributing to our understanding of how such rearrangements influence strain-specific adaptations and phenotypes .

Experimental Design Considerations for YAR064W Studies

Q: What expression systems are most suitable for recombinant production of YAR064W protein?

A: When designing expression systems for recombinant YAR064W production, researchers should consider homologous expression within S. cerevisiae itself, using strong inducible promoters such as GAL1 or TEF1 to overcome the naturally low expression levels of this subtelomeric pseudogene . Codon optimization is generally unnecessary when expressing within its native host, but becomes crucial if heterologous systems such as E. coli or P. pastoris are employed, given the different codon usage preferences across species. Expression vectors should incorporate affinity tags (His6, FLAG, or GST) for purification and detection, placed at either terminus with linker sequences and protease cleavage sites to maintain native protein folding while facilitating downstream applications. For structural studies, researchers might consider fusion constructs with stability-enhancing partners like maltose-binding protein (MBP) or thioredoxin, especially given YAR064W's pseudogenic nature which might present challenges to stable folding . When attempting functional characterization, conditional expression systems that allow precise temporal control may help identify transient interactions or phenotypes that might otherwise be missed in constitutive expression approaches.

Q: How should researchers approach phenotypic screening when studying YAR064W function?

A: Given YAR064W's similarity to flocculins, phenotypic screening approaches should prioritize assays related to cell adhesion, biofilm formation, and flocculation under various growth conditions including nutrient limitation, pH variation, and osmotic stress . A comprehensive approach would involve creating both deletion strains (yar064wΔ) and overexpression constructs in multiple genetic backgrounds, particularly comparing laboratory strains like S288c with industrial strains such as JAY270 where YAR064W has been implicated in chromosomal rearrangements . High-throughput phenotypic arrays (such as Biolog or similar technologies) can help identify condition-specific growth differences between wildtype and modified strains, which should be followed by targeted validation experiments. Given YAR064W's interaction network of 35 edges, researchers should consider epistasis analysis with known interactors, particularly YAR068W, YAR069C, and YAR070C, which show the highest STRING interaction scores (>0.79) . When designing such screens, it's important to account for potential redundancy with its paralog YHR213W-B by creating double-knockout strains, as functional complementation might mask phenotypes in single-gene studies .

Data Analysis and Interpretation Challenges

Q: How can researchers distinguish between genuine YAR064W expression and artifacts from adjacent genomic regions?

A: Accurately distinguishing genuine YAR064W expression from neighboring transcriptional activity requires implementing a multi-faceted approach to transcriptomic data analysis. Researchers should employ strand-specific RNA sequencing with deep coverage to precisely map transcript boundaries, complemented by 5' and 3' RACE (Rapid Amplification of cDNA Ends) to definitively identify the start and end points of transcripts in the YAR064W region . Previous studies have demonstrated that reads mapping to YAR064W often represent the peripheral regions of transcripts from adjacent, unannotated genomic elements rather than expression of the YAR064W coding sequence itself . To validate expression findings, researchers should design multiple primer pairs or probes that specifically target different regions within the YAR064W sequence for RT-qPCR analysis, avoiding regions with sequence similarity to other genomic loci. Northern blot analysis with probes specific to different regions of YAR064W and surrounding sequences can provide further confirmation of transcript size and abundance, helping to distinguish between full-length YAR064W transcripts and partial transcripts from neighboring genes . When interpreting these data, researchers should also consider the chromatin state of the region, as YAR064W resides in a largely silent subtelomeric region where transcription may be epigenetically regulated.

Q: What approaches should be used to analyze potential functional relationships in YAR064W's protein interaction network?

A: Analysis of YAR064W's protein interaction network should begin with critical evaluation of the STRING database findings, which indicate 35 potential interactions with an average node degree of 6.36 and a high clustering coefficient of 0.899, suggesting a significant enrichment of interactions (p-value: 7.39e-10) . Researchers should prioritize validation of high-confidence interactions, particularly with YAR068W (score 0.801), YAR069C (score 0.795), and YAR070C (score 0.794), using complementary experimental approaches such as co-immunoprecipitation, yeast two-hybrid assays, and proximity labeling techniques like BioID or APEX . Network analysis should incorporate Gene Ontology enrichment to identify functional clusters, with special attention to the fact that many of YAR064W's predicted interactors are also uncharacterized proteins or dubious ORFs, suggesting a possible functional module of novel proteins. Temporal and condition-specific interaction patterns should be investigated using quantitative proteomics approaches such as SILAC or TMT labeling under various stress conditions and growth phases. Researchers should also perform comparative network analysis between YAR064W and its paralog YHR213W-B to identify conserved and divergent interaction partners, potentially revealing functional specialization following gene duplication .

Functional Characterization Methodologies

Q: What are the best techniques for investigating YAR064W's potential role in chromosomal rearrangements?

A: Investigating YAR064W's role in chromosomal rearrangements should begin with comprehensive comparative genomic hybridization (CGH-array) and band-array analyses across multiple yeast strains, building upon previous studies that identified rearrangements involving YAR064W between laboratory strain S288c and industrial strain JAY270 . Pulse-field gel electrophoresis (PFGE) combined with Southern blot analysis using YAR064W-specific probes can further elucidate chromosome length polymorphisms and the distribution of YAR064W across different chromosomes in diverse yeast isolates . To directly assess YAR064W's contribution to genome instability, researchers should engineer strains with strategic insertions of reporter constructs flanking YAR064W and monitor recombination rates under various stress conditions, particularly those relevant to industrial fermentation environments. CRISPR-Cas9 genome editing can be employed to create precise deletions, duplications, or relocations of YAR064W to different chromosomal contexts, followed by long-term evolution experiments to track resulting chromosomal dynamics . Hi-C or similar chromosome conformation capture techniques would provide valuable insights into whether regions containing YAR064W engage in frequent inter-chromosomal contacts that might facilitate ectopic recombination, potentially explaining its involvement in the translocation observed between chromosomes 1 and 6 in industrial strains .

Q: How can researchers determine if YAR064W has retained any functional aspects despite being classified as a pseudogenic fragment?

A: To assess potential functional retention in YAR064W despite its pseudogenic classification, researchers should conduct detailed comparative sequence analysis against functional flocculin genes, focusing on identification of conserved domains, active sites, or regulatory motifs that may remain intact within YAR064W . Heterologous expression of YAR064W in flocculin-deficient yeast strains, followed by assays for cell aggregation, biofilm formation, and adhesion to various substrates, would reveal any residual flocculin-like activity. Researchers should perform systematic mutagenesis of conserved residues identified through sequence analysis, potentially revealing functional constraints through evolutionary rate analysis of synonymous versus non-synonymous substitutions between YAR064W and homologous sequences across related yeast species . Given YAR064W's presence in a largely silent subtelomeric region, epigenetic activation through histone deacetylase inhibitors or deletion of silencing factors might unmask conditional expression patterns linked to specific environmental stresses or developmental stages . Ribosome profiling would definitively establish whether YAR064W transcripts are translated into protein in vivo, while mass spectrometry approaches could detect potential post-translational modifications that might be required for any residual function of this pseudogenic fragment.

Techniques for Analyzing Genomic Context and Strain Variation

Q: What methods are most effective for analyzing YAR064W copy number variations across different yeast strains?

A: Quantitative PCR (qPCR) with primers specific to YAR064W provides a rapid initial assessment of copy number variations, though researchers should design controls that account for potential cross-amplification of its paralog YHR213W-B . For genome-wide perspectives, comparative genomic hybridization (CGH-array) offers comprehensive detection of copy number variations and has previously revealed amplifications of YAR064W in industrial strains compared to laboratory references . Digital PCR provides superior precision for absolute quantification of copy numbers and is particularly valuable for detecting fractional changes in mixed populations or during evolution experiments. Whole genome sequencing with long-read technologies (Oxford Nanopore or PacBio) is essential for resolving the precise locations of YAR064W copies, especially in complex rearrangements where conventional short-read approaches may struggle to correctly map duplicated regions . Southern blot analysis of pulse-field gel electrophoresis (PFGE) separations has proven effective for visualizing chromosomal distributions of YAR064W across multiple strains, as demonstrated in previous studies that identified translocations involving this gene between chromosome 1 and chromosome 6 in industrial strains .

Q: How should researchers approach the analysis of transcriptional regulation of YAR064W in different genetic backgrounds?

A: Analysis of YAR064W transcriptional regulation requires careful consideration of its subtelomeric location, which is typically subject to silencing mechanisms that may vary between strains . Chromatin immunoprecipitation (ChIP) assays targeting silencing factors like Sir2p/Sir3p/Sir4p and histone modifications (H3K9me, H4K16ac) around the YAR064W locus can reveal strain-specific differences in chromatin structure that influence expression potential. RT-qPCR should be performed using multiple reference genes validated for stability across the genetic backgrounds being compared, with primers designed to distinguish YAR064W transcripts from its paralog YHR213W-B . Researchers should consider strand-specific RNA-seq to accurately detect antisense transcription and potential regulatory non-coding RNAs in the YAR064W region, which might contribute to expression differences between strains . Reporter constructs with YAR064W promoter regions driving fluorescent protein expression can provide visual confirmation of regulation patterns and facilitate high-throughput screening for trans-acting factors through genetic screens. When analyzing industrial strains like JAY270, researchers should account for potential position effects following chromosomal rearrangements, as YAR064W has been observed in novel genomic contexts that might subject it to different regulatory influences compared to laboratory strains .

Protein-Level Characterization Methods

Q: What analytical techniques should be employed to characterize the structural properties of recombinant YAR064W protein?

A: Structural characterization of recombinant YAR064W should begin with circular dichroism (CD) spectroscopy to assess secondary structure content, followed by more detailed analysis through nuclear magnetic resonance (NMR) spectroscopy if the protein is amenable to isotopic labeling and maintains stability in solution. Given YAR064W's similarity to flocculins, which typically contain β-sheet-rich domains involved in carbohydrate binding, researchers should employ differential scanning calorimetry (DSC) and isothermal titration calorimetry (ITC) to evaluate thermal stability and binding interactions with potential carbohydrate ligands . For quaternary structure analysis, analytical ultracentrifugation and size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine oligomerization states under various conditions. X-ray crystallography remains the gold standard for high-resolution structure determination if diffraction-quality crystals can be obtained, though cryo-electron microscopy (cryo-EM) offers an alternative approach particularly suitable if YAR064W forms larger assemblies or associates with membrane components as suggested by its flocculin similarity . Given the pseudogenic classification of YAR064W, researchers should also consider comparing structural features with its paralog YHR213W-B and functional flocculins to identify possible defects or retained structural elements that might inform functional studies .

Q: What methods are recommended for detecting potential post-translational modifications of YAR064W?

A: Comprehensive analysis of YAR064W post-translational modifications (PTMs) should employ mass spectrometry-based proteomics with sample preparation methods optimized for different PTM classes, including enrichment strategies for phosphorylation (TiO₂ or IMAC), glycosylation (lectin affinity or hydrazide chemistry), and ubiquitination (di-Gly remnant antibodies). Given the similarity of YAR064W to flocculins, which are typically highly glycosylated, researchers should prioritize techniques optimized for O-mannosylation and N-glycosylation detection, such as enzymatic deglycosylation followed by mass shift analysis or glycan-specific stains following SDS-PAGE separation . Western blotting with modification-specific antibodies provides targeted validation of key PTMs identified through proteomics, while metabolic labeling approaches using azide-containing sugars or amino acids enable detection of newly added modifications in pulse-chase experiments. To correlate modifications with function, site-directed mutagenesis of modified residues followed by functional assays for protein stability, localization, and interaction capabilities would be essential. Researchers should consider comparative PTM analysis between YAR064W and its paralog YHR213W-B to identify conserved modification patterns that might indicate functionally important sites despite the pseudogenic classification .

Industrial and Biotechnological Implications

Q: How might understanding YAR064W contribute to improving industrial yeast strains for bioprocessing applications?

A: Understanding YAR064W's role in genomic rearrangements between laboratory and industrial strains provides critical insights for rational genome engineering of improved industrial yeasts. Previous studies have demonstrated that YAR064W is involved in translocations that contribute to chromosome length polymorphisms between the laboratory strain S288c and the industrial strain JAY270, with potential implications for industrial adaptations including ethanol tolerance, stress resistance, and fermentation efficiency . By characterizing how such rearrangements contribute to favorable industrial phenotypes, researchers can design targeted chromosome engineering strategies that replicate advantageous genomic architectures without the need for lengthy adaptation processes. The observation that YAR064W is duplicated in both laboratory and industrial strains at the right end of chromosome 8 suggests potential selective advantages that could be leveraged in strain development, particularly if these duplications enhance subtelomeric plasticity that facilitates rapid adaptation to changing environmental conditions . For industrial applications requiring cell surface display or flocculation control, the flocculin-like characteristics of YAR064W might be exploited through fusion constructs or regulatory modifications, even if the native protein lacks full functionality . Researchers developing next-generation industrial strains should consider screening YAR064W copy number and chromosomal location as potential biomarkers for desirable industrial traits, given their observed correlation with stress tolerance and fermentation performance in existing industrial isolates .

Comparative Analysis Applications

Q: How can comparative analysis of YAR064W across Saccharomyces species inform evolutionary studies?

A: Comparative genomic analysis of YAR064W orthologs and paralogs across the Saccharomyces genus provides a powerful framework for studying the evolutionary dynamics of subtelomeric regions and pseudogenization processes. Researchers should conduct phylogenetic analysis to determine whether YAR064W represents an ancestral gene that underwent pseudogenization in S. cerevisiae or if it arose through partial duplication events from functional flocculin genes . Synteny analysis across closely related yeast species can reveal the timing and mechanisms of the segmental duplication that gave rise to YAR064W and its paralog YHR213W-B, providing insights into chromosomal rearrangement rates in evolutionary timescales . By comparing selection pressures (dN/dS ratios) on YAR064W across species with different ecological niches, researchers can test hypotheses about environment-specific selective forces that might maintain certain features of this pseudogenic fragment. Analysis of expression patterns and chromosomal positioning of YAR064W homologs across the Saccharomyces sensu stricto group may reveal lineage-specific regulatory innovations or subtelomeric expansion patterns that contribute to speciation and niche adaptation. Given the involvement of YAR064W in chromosomal rearrangements between laboratory and industrial S. cerevisiae strains, comparative analysis could identify similar rearrangement hotspots in related species that might function as drivers of genome evolution and strain diversification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.