Recombinant Saccharomyces cerevisiae Uncharacterized protein YBR063C (YBR063C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YBR063C; YBR0610; Uncharacterized protein YBR063C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR063C
Target Protein Sequence
MEELGLKSTFPYEYGSDFTMIRTEMLNTTKSETTILFSNIKSILAIIWKYSFTFLRSFSD SIKLIIDDVVTIGSRNFAERLQIEAKKNNDQEDIWASTIILGVIIGYLISSIKRKNTFPI MPTSSPKIDDCRFKTGDTISIVINFNEDCLNNRSDVTEERNYEESTVLHSKESVLSIGRQ NMVTLNQSDENFTYGNFDEYDLLTKDYTTEVLTRSPGSNPEFKAVVNNTLLDSANETPFK GIEKSINETMVKVPMGCDVSLSHYGRQYAPGNISIMRSFTARDNTKSVSREIRDICKSFL IIKSQFGDELFLTMFMEKPVFFDNNIPIEITGAYREKRERLDEVIHKDLIRYDEVQNLTR IRNLLRVKSQKICSRRHNSSVPTKKLLVNDKGATSILLWYSNYS
Uniprot No.

Target Background

Database Links

KEGG: sce:YBR063C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YBR063C and what is its current nomenclature in S. cerevisiae research?

YBR063C has been renamed Cnm1 (Contact Nucleus Mitochondria 1) following characterization of its function as a molecular tether between the nucleus and mitochondria in Saccharomyces cerevisiae. This previously uncharacterized protein was identified through high-throughput screening that uncovered its role in mediating specific areas of contact between these two organelles . The nomenclature change reflects its functional role in cellular organization, moving from the systematic ORF (Open Reading Frame) designation to a function-based name that aids researchers in recalling its primary role.

What is the subcellular localization of Cnm1 (YBR063C) and how can it be visualized?

Cnm1 (YBR063C) is localized at discrete regions on the nuclear envelope that make contact with mitochondria. Visualization can be achieved through fluorescent protein tagging, specifically N-terminal tagging with mCherry (mCherry-Cnm1), which allows for observation of its distribution at nuclear-mitochondrial contact points . The protein has been confirmed to be an integral membrane protein embedded in the lipid bilayer through carbonate extraction experiments, which demonstrated that similar to the mitochondrial outer membrane protein Tom20, 3HA-tagged Cnm1 remains in the membrane fraction following treatment . Advanced imaging techniques, including electron microscopy and cryoelectron tomography with 3D segmentation, provide further confirmation of Cnm1's role in forming abundant nucleus-mitochondria contacts, particularly when the protein is overexpressed .

How does Cnm1 (YBR063C) differ from proteins involved in ERMES-mediated contacts?

Cnm1 functions independently from the ERMES (ER-Mitochondria Encounter Structure) complex, which mediates a different set of organelle contacts. Research has demonstrated that Cnm1 is not directly related to ERMES components based on several lines of evidence:

  • Overexpression or deletion of Cnm1 does not affect the extent of ERMES patches (visualized through Mmm1-GFP or Mdm34-GFP)

  • There are areas of Cnm1 expression that do not colocalize with ERMES components and vice versa

  • Genetic interaction studies show that combining Δmdm34 (an ERMES component deletion) with Cnm1 repression exacerbates growth defects beyond those observed with Δmdm34 alone

  • While loss of both vam6 (reducing mitochondria-vacuole contacts) and ERMES is synthetic lethal, Cnm1 repression on a Δvam6 background actually rescues the growth defect, pointing to distinct functions

These findings collectively establish Cnm1 as part of a novel contact system rather than an extension of the previously characterized ERMES complex.

What experimental designs are most appropriate for investigating Cnm1 (YBR063C) function?

When investigating Cnm1 function, researchers should consider the following experimental designs:

  • Independent Groups Design: This approach is suitable for comparing wildtype versus Cnm1 knockout/overexpression strains, where different groups of yeast cells are used for each condition. This design eliminates order effects but requires careful control of participant variables (genetic background differences) . For Cnm1 studies, this could involve comparing mitochondrial distribution patterns between wildtype and cnm1Δ strains.

  • Repeated Measures Design: This is appropriate for experiments tracking changes in Cnm1 localization or function over time or under different conditions using the same cell populations. This design reduces variability from individual differences but risks order effects that must be controlled through counterbalancing . For example, this could be used when examining Cnm1 expression under varying phospholipid concentrations over time.

  • Matched Pairs Design: This design can be useful when investigating Cnm1 alongside its interaction partner Tom70, ensuring that variables such as cell cycle stage are matched between experimental groups .

For visualization of Cnm1-mediated contacts, combining fluorescence microscopy with electron microscopy provides complementary data. Fluorescence microscopy enables real-time tracking of protein dynamics, while electron microscopy and cryoelectron tomography offer high-resolution structural information about the contacts .

What molecular techniques are effective for manipulating Cnm1 (YBR063C) expression in S. cerevisiae?

Several molecular techniques have proven effective for manipulating Cnm1 expression in S. cerevisiae:

  • Inducible Promoter Systems: Time-lapse analysis of Cnm1 induction using galactose-inducible promoters has demonstrated that increased proximity between mitochondria and the nucleus occurs after random contact between the organelles . This system allows for controlled expression timing.

  • Strong Constitutive Promoters: Overexpression of untagged Cnm1 under the strong TEF2 promoter has a striking effect on mitochondrial distribution, causing clustering around the perinuclear region with a nearly twofold increase in proximity between the two organelles .

  • Genome Integration: For stable expression, genome-integrated recombinant strains are preferable, as demonstrated in similar work with S. cerevisiae strain ST1814G (MATa aga1 his3Δ200 leu2Δ0 lys2Δ0 trp1Δ63 ura3Δ0 met15Δ0) .

  • Protein Tagging Strategies: N-terminal tagging with fluorescent proteins (mCherry) or small epitope tags (3HA) has been successfully employed without disrupting Cnm1 function, allowing for both visualization and biochemical characterization .

These techniques can be combined with phosphatidylcholine metabolism modulation to investigate the regulation of Cnm1-mediated contacts, as Cnm1 abundance is regulated by phosphatidylcholine levels .

How can researchers quantify nucleus-mitochondria contacts mediated by Cnm1 (YBR063C)?

Quantification of nucleus-mitochondria contacts mediated by Cnm1 can be achieved through multiple complementary approaches:

  • Proximity Analysis: Measuring the relative proximity between mitochondria and the nuclear periphery using fluorescence microscopy. Studies have shown a nearly twofold increase in proximity between these organelles when Cnm1 is overexpressed .

  • Contact Site Enumeration: Using electron microscopy to count the number of discrete contact sites between the nuclear envelope and mitochondria. Cryoelectron tomography with 3D segmentation provides particularly clear visualization of these contacts .

  • Colocalization Analysis: Quantifying the degree of colocalization between nuclear envelope markers, mitochondrial markers, and Cnm1. Full colocalization of Cnm1 with reporter proteins has been observed in previous studies .

  • Time-lapse Imaging: Monitoring the dynamic formation of contacts using live-cell imaging after Cnm1 induction, which has revealed that increased proximity results from adherence of mitochondria to the nucleus following random contact events .

Data from these complementary techniques should be analyzed using appropriate statistical methods, with quantification of multiple cells across independent experiments to ensure reproducibility and biological significance.

What transcriptomic approaches can be used to study the impact of Cnm1 (YBR063C) on gene expression?

Studying the impact of Cnm1 on gene expression requires sophisticated transcriptomic approaches:

  • Microarray Analysis: Similar to the technique described for yeast cell cycle gene analysis in Spellman et al., microarray technology allows examination of transcriptional activity for thousands of genes under different conditions . For Cnm1 research, comparing gene expression profiles between wildtype and cnm1Δ strains could reveal downstream effects of nucleus-mitochondria contacts on nuclear gene expression.

  • Clustering Algorithms: The superparamagnetic clustering algorithm (SPC) and its modified version SPCTF (which incorporates transcription factor binding information) can be applied to microarray data to discover biologically relevant information . These algorithms can identify groups of genes whose expression changes correlate with Cnm1 modulation.

  • Combined Similarity Measures: Utilizing approaches that integrate multiple data types, such as expression profiles and shared transcription factor binding to promoters, can provide more comprehensive analysis . For Cnm1 studies, this could involve correlating changes in gene expression with alterations in nuclear-mitochondrial contacts.

  • Time-course Expression Analysis: Tools like SCEPTRANS can be used to analyze expression profiles over time, particularly useful for examining how nuclear-mitochondrial contacts might influence gene expression during cell cycle progression or stress responses .

These transcriptomic approaches should be combined with validation experiments using reporter genes and qPCR to confirm findings from high-throughput analyses.

What is the relationship between Cnm1 (YBR063C) and phospholipid metabolism in S. cerevisiae?

The relationship between Cnm1 and phospholipid metabolism in S. cerevisiae is a critical aspect of its function:

  • Regulation by Phosphatidylcholine: Research has demonstrated that Cnm1 abundance is regulated by phosphatidylcholine (PC) levels, enabling coupling of phospholipid homeostasis with nucleus-mitochondria contact extent . This regulatory relationship suggests a feedback mechanism that connects membrane composition with interorganelle communication.

  • Membrane Contact Sites and Lipid Transfer: Nucleus-mitochondria contacts mediated by Cnm1 may facilitate phospholipid transfer between these organelles, similar to how other membrane contact sites function in lipid homeostasis. This aspect remains to be fully characterized but represents an important avenue for investigation.

  • Impact on Mitochondrial Membrane Composition: Changes in Cnm1-mediated contacts likely influence the lipid composition of mitochondrial membranes, potentially affecting mitochondrial function, dynamics, and response to cellular stress.

  • Experimental Approaches: Researchers can investigate this relationship by:

    • Manipulating phosphatidylcholine synthesis pathways and observing effects on Cnm1 localization and abundance

    • Using lipidomics to analyze changes in membrane composition at contact sites

    • Employing lipid transfer assays with fluorescent lipid analogs to measure exchange at Cnm1-mediated contacts

Understanding this relationship is essential for comprehending how cells coordinate phospholipid metabolism with interorganelle communication.

How does Cnm1 (YBR063C) interact with Tom70 to establish nucleus-mitochondria contacts?

The interaction between Cnm1 and Tom70 in establishing nucleus-mitochondria contacts involves specific molecular mechanisms:

  • Protein-Protein Interaction: Cnm1 on the nuclear membrane directly interacts with Tom70 on the mitochondrial outer membrane to form a molecular bridge between these organelles . Tom70 is a component of the TOM (translocase of outer membrane) complex normally involved in protein import into mitochondria.

  • Dual Tethering System: The Cnm1-Tom70 interaction represents a dedicated tethering system that is independent of the ERMES complex, establishing a distinct pathway for nucleus-mitochondria communication .

  • Sufficiency for Contact Formation: Research has demonstrated that Cnm1 and Tom70 are sufficient for contact site formation, as evidenced by:

    • The extensive clustering of mitochondria around the nucleus when Cnm1 is overexpressed

    • The observation of bona fide contact sites using electron microscopy and cryoelectron tomography

  • Methodological Approaches to Study This Interaction:

    • Co-immunoprecipitation experiments to confirm direct binding

    • FRET (Förster Resonance Energy Transfer) analysis to measure proximity in vivo

    • Mutational analysis of both proteins to identify critical interaction domains

    • In vitro reconstitution systems using purified components

Understanding the structural basis of this interaction could provide insights into the molecular mechanisms governing interorganelle communication and potential therapeutic targets for mitochondrial disorders.

What statistical approaches are appropriate for analyzing Cnm1 (YBR063C) localization and function?

When analyzing Cnm1 localization and function, several statistical approaches are appropriate:

  • Correlation Analysis: Pearson correlation, Spearman rank correlation, or Euclidean distance measurements can be used to quantify relationships between Cnm1 expression levels and mitochondrial proximity to the nucleus . These approaches help determine if there is a dose-dependent relationship between Cnm1 abundance and contact site formation.

  • Distance Metrics: City block or Manhattan distance calculations are useful for measuring the spatial relationship between organelles in microscopy data, providing quantitative assessment of changes in organelle proximity .

  • Clustering Algorithms: For analyzing large datasets of gene expression or protein localization patterns related to Cnm1 function, hierarchical clustering approaches can identify patterns and relationships . The memory complexity of such algorithms is quadratic in the number of objects to be grouped, O(n²), which limits the size of datasets that can be analyzed with this approach .

  • Statistical Tests for Experimental Data:

    • For comparing contact site abundance between wildtype and mutant strains: t-tests or ANOVA

    • For time-course experiments: repeated measures ANOVA or mixed-effects models

    • For non-normally distributed data: non-parametric alternatives like Mann-Whitney U or Kruskal-Wallis tests

These statistical approaches should be implemented with appropriate controls for multiple testing and validation across independent biological replicates.

How can researchers differentiate between direct and indirect effects of Cnm1 (YBR063C) manipulation?

Differentiating between direct and indirect effects of Cnm1 manipulation requires careful experimental design and controls:

  • Acute vs. Chronic Manipulation: Using inducible expression systems, such as the galactose-inducible promoter used in time-lapse analysis of Cnm1 , allows researchers to observe immediate effects of Cnm1 induction, which are more likely to be direct consequences rather than adaptive responses.

  • Complementation Studies: Expressing wildtype Cnm1 in knockout strains should rescue direct phenotypes, while domain-specific mutants can help define which protein functions are essential for specific cellular outcomes.

  • Temporal Analysis: Time-course experiments following Cnm1 induction or depletion can establish the sequence of events, helping distinguish primary (direct) from secondary (indirect) effects. Video analysis has shown that after Cnm1 induction, increased nucleus-mitochondria proximity results from adherence following random contact events .

  • Genetic Interaction Studies: Systematic analysis of genetic interactions, such as those performed with mdm34 and vam6 deletions , can reveal functional relationships and help distinguish direct from indirect effects.

  • Biochemical Approaches:

    • In vitro reconstitution of nucleus-mitochondria contacts using purified components

    • Proximity labeling techniques to identify proteins directly interacting with Cnm1

    • Crosslinking followed by mass spectrometry to identify direct binding partners

By combining these approaches, researchers can build a comprehensive understanding of Cnm1's direct functions versus downstream consequences of altered nucleus-mitochondria contacts.

What are the potential functional implications of nucleus-mitochondria contacts mediated by Cnm1 (YBR063C)?

The nucleus-mitochondria contacts mediated by Cnm1 likely serve several important cellular functions that merit investigation:

  • Gene Expression Regulation: Direct communication between mitochondria and the nucleus could facilitate retrograde signaling, allowing mitochondrial status to influence nuclear gene expression. This may be particularly important during stress responses or metabolic adaptation.

  • DNA Repair and Genome Stability: Proximity between mitochondria and the nucleus might influence mitochondrial DNA repair mechanisms or nuclear DNA stability, possibly through shared components or coordinated responses to DNA damage.

  • Metabolite Exchange: These contacts could facilitate the transfer of metabolites between organelles, including ATP, calcium ions, or intermediates of biosynthetic pathways.

  • Phospholipid Transfer: As Cnm1 abundance is regulated by phosphatidylcholine , these contacts likely play a role in phospholipid homeostasis and membrane biogenesis for both organelles.

  • Cell Cycle Coordination: The contacts may help coordinate mitochondrial division and distribution with nuclear events during cell division, ensuring proper inheritance of both mitochondria and nuclei.

Future studies should systematically test these hypotheses using a combination of genetic, biochemical, and imaging approaches to establish the physiological significance of Cnm1-mediated contacts.

How can researchers apply knowledge about Cnm1 (YBR063C) to studies of related proteins in higher eukaryotes?

Applying knowledge about Cnm1 to studies of related proteins in higher eukaryotes involves several strategic approaches:

  • Homology Searches and Structural Prediction: While direct sequence homology might be limited, researchers should look for proteins with similar domain architecture, membrane topology, or predicted secondary structure in higher eukaryotes.

  • Functional Complementation Experiments: Testing whether putative mammalian homologs can rescue phenotypes in cnm1Δ yeast strains can help identify functional equivalents despite limited sequence conservation.

  • Comparative Interactome Analysis: Identifying proteins that interact with Tom70 homologs in mammalian cells might reveal functional Cnm1 counterparts that similarly mediate nucleus-mitochondria contacts.

  • Cross-Species Experimental Design:

    • Researchers can apply similar experimental approaches used to characterize Cnm1 in yeast to mammalian cells

    • This includes proximity analysis between organelles, membrane extraction tests, and imaging of contact sites using electron microscopy

    • Adaptations of these techniques should account for differences in cellular organization and experimental accessibility

  • Translational Research Considerations: Knowledge about nucleus-mitochondria contacts may have implications for understanding mitochondrial diseases, aging, and cancer, where interorganelle communication is often disrupted.

By building on foundational knowledge from yeast studies, researchers can develop more targeted approaches to investigating similar processes in complex eukaryotic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.